Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (17 Jun 2020)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Luc7-like protein 3

Gene

Luc7l3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processmRNA processing, mRNA splicing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Luc7-like protein 3
Alternative name(s):
Cisplatin resistance-associated-overexpressed protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Luc7l3
Synonyms:Crop
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1914934 Luc7l3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002334111 – 432Luc7-like protein 3Add BLAST432

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei3PhosphoserineBy similarity1
Modified residuei110PhosphoserineBy similarity1
Modified residuei115PhosphoserineBy similarity1
Modified residuei231N6-acetyllysineBy similarity1
Modified residuei420PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki424Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki424Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei425PhosphoserineCombined sources1
Modified residuei431PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5SUF2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SUF2

PeptideAtlas

More...
PeptideAtlasi
Q5SUF2

PRoteomics IDEntifications database

More...
PRIDEi
Q5SUF2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SUF2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SUF2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5SUF2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020863 Expressed in metanephric cortical collecting duct and 292 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SUF2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SUF2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May interact with SFRS1 and form homodimers.

Interacts with JMJD6.

Interacts with RBM25.

Interacts with RSRC1 (via Arg/Ser-rich domain).

Interacts with RRP1B.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
212365, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SUF2, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000021226

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5SUF2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5SUF2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili124 – 181Sequence analysisAdd BLAST58

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi228 – 282Glu-richAdd BLAST55
Compositional biasi235 – 395Arg/Ser-richAdd BLAST161

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Luc7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0796 Eukaryota
COG5200 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183213

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_030397_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SUF2

Identification of Orthologs from Complete Genome Data

More...
OMAi
ELNWEDP

Database of Orthologous Groups

More...
OrthoDBi
1499212at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SUF2

TreeFam database of animal gene trees

More...
TreeFami
TF354312

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004882 Luc7-rel

The PANTHER Classification System

More...
PANTHERi
PTHR12375 PTHR12375, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03194 LUC7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SUF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MISAAQLLDE LMGRDRNLAP DEKRSNVRWD HESVCKYYLC GFCPAELFTN
60 70 80 90 100
TRSDLGPCEK IHDENLRKQY EKSSRFMKVG YERDFLRYLQ SLLAEVERRI
110 120 130 140 150
RRGHARLALS QNQQSSGAAG PTGKNEEKIQ VLTDKIDVLL QQIEELGSEG
160 170 180 190 200
KVEEAQGMMK LVEQLKEERE LLRSTTSTIE SFAAQEKQME VCEVCGAFLI
210 220 230 240 250
VGDAQSRVDD HLMGKQHMGY AKIKATVEEL KEKLRKRTEE PDRDERLKKE
260 270 280 290 300
KQEREEREKE REREREERER KRRREEEERE KERARDRERR KRSRSRSRHS
310 320 330 340 350
SRTSDRRCSR SRDHKRSRSR DRRRSRSRDR RRSRSHDRSE RKHRSRSRDR
360 370 380 390 400
RRSKSRDRKS YKHRSKSRDR EQDRKSKEKE KKGSDDKKSS VKSSSREKQS
410 420 430
EDTNPESKES DTKNEVNGTS EDIKSEGDTQ SN
Length:432
Mass (Da):51,450
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2546F0AE9A0CC160
GO
Isoform 2 (identifier: Q5SUF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI

Show »
Length:491
Mass (Da):58,436
Checksum:iC51A22CF78055CE7
GO
Isoform 3 (identifier: Q5SUF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRTTVEEFLKNTENGIK

Show »
Length:477
Mass (Da):56,778
Checksum:i84FE7F03C5B58211
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F7A7G1F7A7G1_MOUSE
Luc7-like protein 3
Luc7l3
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CR21F7CR21_MOUSE
Luc7-like protein 3
Luc7l3
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WGA8F8WGA8_MOUSE
Luc7-like protein 3
Luc7l3
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti402D → E in BAC39261 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018138427 – 432GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRYIVL SQLFCSRLRAPISVPLWKLL STYVI in isoform 2. 1 Publication6
Alternative sequenceiVSP_018139427 – 432GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRTTVE EFLKNTENGIK in isoform 3. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK014362 mRNA Translation: BAB29297.1
AK019464 mRNA Translation: BAB31736.1
AK084714 mRNA Translation: BAC39261.1
AK151228 mRNA Translation: BAE30220.1
AK151839 mRNA Translation: BAE30732.1
AL645846 Genomic DNA No translation available.
AL645965 Genomic DNA No translation available.
BC009092 mRNA Translation: AAH09092.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25252.1 [Q5SUF2-2]
CCDS88223.1 [Q5SUF2-1]
CCDS88224.1 [Q5SUF2-3]

NCBI Reference Sequences

More...
RefSeqi
NP_080589.1, NM_026313.1 [Q5SUF2-2]
XP_006534073.1, XM_006534010.3
XP_006534074.1, XM_006534011.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863 [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863 [Q5SUF2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
67684

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:67684

UCSC genome browser

More...
UCSCi
uc007kyh.1 mouse [Q5SUF2-2]
uc007kyi.1 mouse [Q5SUF2-1]
uc007kyj.1 mouse [Q5SUF2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014362 mRNA Translation: BAB29297.1
AK019464 mRNA Translation: BAB31736.1
AK084714 mRNA Translation: BAC39261.1
AK151228 mRNA Translation: BAE30220.1
AK151839 mRNA Translation: BAE30732.1
AL645846 Genomic DNA No translation available.
AL645965 Genomic DNA No translation available.
BC009092 mRNA Translation: AAH09092.1
CCDSiCCDS25252.1 [Q5SUF2-2]
CCDS88223.1 [Q5SUF2-1]
CCDS88224.1 [Q5SUF2-3]
RefSeqiNP_080589.1, NM_026313.1 [Q5SUF2-2]
XP_006534073.1, XM_006534010.3
XP_006534074.1, XM_006534011.3

3D structure databases

SMRiQ5SUF2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi212365, 3 interactors
IntActiQ5SUF2, 2 interactors
STRINGi10090.ENSMUSP00000021226

PTM databases

iPTMnetiQ5SUF2
PhosphoSitePlusiQ5SUF2
SwissPalmiQ5SUF2

Proteomic databases

EPDiQ5SUF2
PaxDbiQ5SUF2
PeptideAtlasiQ5SUF2
PRIDEiQ5SUF2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
18160 90 antibodies

Genome annotation databases

EnsembliENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863 [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863 [Q5SUF2-3]
GeneIDi67684
KEGGimmu:67684
UCSCiuc007kyh.1 mouse [Q5SUF2-2]
uc007kyi.1 mouse [Q5SUF2-1]
uc007kyj.1 mouse [Q5SUF2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51747
MGIiMGI:1914934 Luc7l3

Phylogenomic databases

eggNOGiKOG0796 Eukaryota
COG5200 LUCA
GeneTreeiENSGT00950000183213
HOGENOMiCLU_030397_0_1_1
InParanoidiQ5SUF2
OMAiELNWEDP
OrthoDBi1499212at2759
PhylomeDBiQ5SUF2
TreeFamiTF354312

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
67684 7 hits in 9 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Luc7l3 mouse

Protein Ontology

More...
PROi
PR:Q5SUF2
RNActiQ5SUF2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020863 Expressed in metanephric cortical collecting duct and 292 other tissues
ExpressionAtlasiQ5SUF2 baseline and differential
GenevisibleiQ5SUF2 MM

Family and domain databases

InterProiView protein in InterPro
IPR004882 Luc7-rel
PANTHERiPTHR12375 PTHR12375, 1 hit
PfamiView protein in Pfam
PF03194 LUC7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLC7L3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SUF2
Secondary accession number(s): Q3U9D5
, Q8BUJ5, Q921Z3, Q9CRS7, Q9CTY4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: December 21, 2004
Last modified: June 17, 2020
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again