Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Luc7-like protein 3

Gene

Luc7l3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • mRNA splice site selection Source: GO_Central
  • RNA splicing Source: UniProtKB

Keywordsi

Molecular functionDNA-binding
Biological processmRNA processing, mRNA splicing

Names & Taxonomyi

Protein namesi
Recommended name:
Luc7-like protein 3
Alternative name(s):
Cisplatin resistance-associated-overexpressed protein
Gene namesi
Name:Luc7l3
Synonyms:Crop
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1914934 Luc7l3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002334111 – 432Luc7-like protein 3Add BLAST432

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei3PhosphoserineBy similarity1
Modified residuei110PhosphoserineBy similarity1
Modified residuei115PhosphoserineBy similarity1
Modified residuei231N6-acetyllysineBy similarity1
Modified residuei420PhosphoserineCombined sources1
Cross-linki424Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki424Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei425PhosphoserineCombined sources1
Modified residuei431PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ5SUF2
PaxDbiQ5SUF2
PeptideAtlasiQ5SUF2
PRIDEiQ5SUF2

PTM databases

iPTMnetiQ5SUF2
PhosphoSitePlusiQ5SUF2
SwissPalmiQ5SUF2

Expressioni

Gene expression databases

BgeeiENSMUSG00000020863 Expressed in 293 organ(s), highest expression level in metanephric cortical collecting duct
CleanExiMM_3300001P08RIK
ExpressionAtlasiQ5SUF2 baseline and differential
GenevisibleiQ5SUF2 MM

Interactioni

Subunit structurei

May interact with SFRS1 and form homodimers. Interacts with JMJD6. Interacts with RBM25. Interacts with RSRC1 (via Arg/Ser-rich domain). Interacts with RRP1B.By similarity

Protein-protein interaction databases

BioGridi212365, 3 interactors
IntActiQ5SUF2, 2 interactors
STRINGi10090.ENSMUSP00000021226

Structurei

3D structure databases

ProteinModelPortaliQ5SUF2
SMRiQ5SUF2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili124 – 181Sequence analysisAdd BLAST58

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi228 – 282Glu-richAdd BLAST55
Compositional biasi235 – 395Arg/Ser-richAdd BLAST161

Sequence similaritiesi

Belongs to the Luc7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0796 Eukaryota
COG5200 LUCA
GeneTreeiENSGT00730000110670
HOGENOMiHOG000215956
HOVERGENiHBG062167
InParanoidiQ5SUF2
OMAiMGKQHVG
OrthoDBiEOG091G0HXI
PhylomeDBiQ5SUF2
TreeFamiTF354312

Family and domain databases

InterProiView protein in InterPro
IPR004882 Luc7-rel
PANTHERiPTHR12375 PTHR12375, 1 hit
PfamiView protein in Pfam
PF03194 LUC7, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SUF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MISAAQLLDE LMGRDRNLAP DEKRSNVRWD HESVCKYYLC GFCPAELFTN
60 70 80 90 100
TRSDLGPCEK IHDENLRKQY EKSSRFMKVG YERDFLRYLQ SLLAEVERRI
110 120 130 140 150
RRGHARLALS QNQQSSGAAG PTGKNEEKIQ VLTDKIDVLL QQIEELGSEG
160 170 180 190 200
KVEEAQGMMK LVEQLKEERE LLRSTTSTIE SFAAQEKQME VCEVCGAFLI
210 220 230 240 250
VGDAQSRVDD HLMGKQHMGY AKIKATVEEL KEKLRKRTEE PDRDERLKKE
260 270 280 290 300
KQEREEREKE REREREERER KRRREEEERE KERARDRERR KRSRSRSRHS
310 320 330 340 350
SRTSDRRCSR SRDHKRSRSR DRRRSRSRDR RRSRSHDRSE RKHRSRSRDR
360 370 380 390 400
RRSKSRDRKS YKHRSKSRDR EQDRKSKEKE KKGSDDKKSS VKSSSREKQS
410 420 430
EDTNPESKES DTKNEVNGTS EDIKSEGDTQ SN
Length:432
Mass (Da):51,450
Last modified:December 21, 2004 - v1
Checksum:i2546F0AE9A0CC160
GO
Isoform 2 (identifier: Q5SUF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI

Show »
Length:491
Mass (Da):58,436
Checksum:iC51A22CF78055CE7
GO
Isoform 3 (identifier: Q5SUF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-432: GDTQSN → VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRTTVEEFLKNTENGIK

Show »
Length:477
Mass (Da):56,778
Checksum:i84FE7F03C5B58211
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WGA8F8WGA8_MOUSE
Luc7-like protein 3
Luc7l3
43Annotation score:
F7A7G1F7A7G1_MOUSE
Luc7-like protein 3
Luc7l3
205Annotation score:
F7CR21F7CR21_MOUSE
Luc7-like protein 3
Luc7l3
72Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti402D → E in BAC39261 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018138427 – 432GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRYIVL SQLFCSRLRAPISVPLWKLL STYVI in isoform 2. 1 Publication6
Alternative sequenceiVSP_018139427 – 432GDTQSN → VQRKYAQMKMELSRVRRHTK ASSEGKDSVVLQNILRTTVE EFLKNTENGIK in isoform 3. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014362 mRNA Translation: BAB29297.1
AK019464 mRNA Translation: BAB31736.1
AK084714 mRNA Translation: BAC39261.1
AK151228 mRNA Translation: BAE30220.1
AK151839 mRNA Translation: BAE30732.1
AL645846, AL645965 Genomic DNA Translation: CAI24700.1
AL645846, AL645965 Genomic DNA Translation: CAI24701.1
AL645965, AL645846 Genomic DNA Translation: CAI25943.1
AL645965, AL645846 Genomic DNA Translation: CAI25944.1
BC009092 mRNA Translation: AAH09092.1
CCDSiCCDS25252.1 [Q5SUF2-2]
RefSeqiNP_080589.1, NM_026313.1 [Q5SUF2-2]
XP_006534073.1, XM_006534010.3
XP_006534074.1, XM_006534011.3
UniGeneiMm.30927

Genome annotation databases

EnsembliENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863 [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863 [Q5SUF2-3]
GeneIDi67684
KEGGimmu:67684
UCSCiuc007kyh.1 mouse [Q5SUF2-2]
uc007kyi.1 mouse [Q5SUF2-1]
uc007kyj.1 mouse [Q5SUF2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014362 mRNA Translation: BAB29297.1
AK019464 mRNA Translation: BAB31736.1
AK084714 mRNA Translation: BAC39261.1
AK151228 mRNA Translation: BAE30220.1
AK151839 mRNA Translation: BAE30732.1
AL645846, AL645965 Genomic DNA Translation: CAI24700.1
AL645846, AL645965 Genomic DNA Translation: CAI24701.1
AL645965, AL645846 Genomic DNA Translation: CAI25943.1
AL645965, AL645846 Genomic DNA Translation: CAI25944.1
BC009092 mRNA Translation: AAH09092.1
CCDSiCCDS25252.1 [Q5SUF2-2]
RefSeqiNP_080589.1, NM_026313.1 [Q5SUF2-2]
XP_006534073.1, XM_006534010.3
XP_006534074.1, XM_006534011.3
UniGeneiMm.30927

3D structure databases

ProteinModelPortaliQ5SUF2
SMRiQ5SUF2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi212365, 3 interactors
IntActiQ5SUF2, 2 interactors
STRINGi10090.ENSMUSP00000021226

PTM databases

iPTMnetiQ5SUF2
PhosphoSitePlusiQ5SUF2
SwissPalmiQ5SUF2

Proteomic databases

EPDiQ5SUF2
PaxDbiQ5SUF2
PeptideAtlasiQ5SUF2
PRIDEiQ5SUF2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863 [Q5SUF2-2]
ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863 [Q5SUF2-1]
ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863 [Q5SUF2-3]
GeneIDi67684
KEGGimmu:67684
UCSCiuc007kyh.1 mouse [Q5SUF2-2]
uc007kyi.1 mouse [Q5SUF2-1]
uc007kyj.1 mouse [Q5SUF2-3]

Organism-specific databases

CTDi51747
MGIiMGI:1914934 Luc7l3

Phylogenomic databases

eggNOGiKOG0796 Eukaryota
COG5200 LUCA
GeneTreeiENSGT00730000110670
HOGENOMiHOG000215956
HOVERGENiHBG062167
InParanoidiQ5SUF2
OMAiMGKQHVG
OrthoDBiEOG091G0HXI
PhylomeDBiQ5SUF2
TreeFamiTF354312

Miscellaneous databases

ChiTaRSiLuc7l3 mouse
PROiPR:Q5SUF2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020863 Expressed in 293 organ(s), highest expression level in metanephric cortical collecting duct
CleanExiMM_3300001P08RIK
ExpressionAtlasiQ5SUF2 baseline and differential
GenevisibleiQ5SUF2 MM

Family and domain databases

InterProiView protein in InterPro
IPR004882 Luc7-rel
PANTHERiPTHR12375 PTHR12375, 1 hit
PfamiView protein in Pfam
PF03194 LUC7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLC7L3_MOUSE
AccessioniPrimary (citable) accession number: Q5SUF2
Secondary accession number(s): Q3U9D5
, Q8BUJ5, Q921Z3, Q9CRS7, Q9CTY4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: December 21, 2004
Last modified: October 10, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again