Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5ST30 (SYVM_HUMAN)

Entry version 159 (02 Jun 2021)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Valine--tRNA ligase, mitochondrial

Gene

VARS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei661ATPBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAminoacyl-tRNA synthetase, Ligase
Biological processProtein biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5ST30

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-379726, Mitochondrial tRNA aminoacylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Valine--tRNA ligase, mitochondrial (EC:6.1.1.9)
Alternative name(s):
Valyl-tRNA synthetase
Short name:
ValRS
Valyl-tRNA synthetase-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VARS2
Synonyms:KIAA1885, VARS2L, VARSL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:21642, VARS2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612802, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5ST30

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000137411.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Combined oxidative phosphorylation deficiency 20 (COXPD20)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA disorder due to mitochondrial respiratory chain complex defects. Clinical features are variable and include muscle weakness with hypotonia, central neurological disease with progressive external ophthalmoplegia, ptosis and ataxia, delayed psychomotor development, cardiomyopathy, abnormal liver function, facial dysmorphism, microcephaly and epilepsy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_071850337T → I in COXPD20; decreased levels of the protein. 1 PublicationCorresponds to variant dbSNP:rs587777585Ensembl.1
Natural variantiVAR_071851349A → T in COXPD20. 1 PublicationCorresponds to variant dbSNP:rs587777583EnsemblClinVar.1
Natural variantiVAR_071852596A → D in COXPD20. 1 PublicationCorresponds to variant dbSNP:rs587777584EnsemblClinVar.1

Keywords - Diseasei

Disease variant, Primary mitochondrial disease

Organism-specific databases

DisGeNET

More...DisGeNETi		57176

MalaCards human disease database

More...MalaCardsi		VARS2
MIMi615917, phenotype

Open Targets

More...OpenTargetsi		ENSG00000137411

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		420728, Combined oxidative phosphorylation defect type 20

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164742816

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5ST30, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		VARS2

Domain mapping of disease mutations (DMDM)

More...DMDMi		296452917

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 26MitochondrionSequence analysisAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000033800027 – 1063Valine--tRNA ligase, mitochondrialAdd BLAST1037

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5ST30

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5ST30

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5ST30

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5ST30

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5ST30

PeptideAtlas

More...PeptideAtlasi		Q5ST30

PRoteomics IDEntifications database

More...PRIDEi		Q5ST30

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		24437
26145
63892 [Q5ST30-1]
63893 [Q5ST30-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5ST30

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5ST30

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000137411, Expressed in right hemisphere of cerebellum and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5ST30, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5ST30, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000137411, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		121426, 84 interactors

Protein interaction database and analysis system

More...IntActi		Q5ST30, 17 interactors

Molecular INTeraction database

More...MINTi		Q5ST30

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000441000

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5ST30, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni25 – 53DisorderedSequence analysisAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi146 – 156'HIGH' regionAdd BLAST11
Motifi658 – 662'KMSKS' region5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi38 – 53Basic and acidic residuesSequence analysisAdd BLAST16

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class-I aminoacyl-tRNA synthetase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0432, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159890

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5ST30

Identification of Orthologs from Complete Genome Data

More...OMAi		RQWYIRN

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5ST30

TreeFam database of animal gene trees

More...TreeFami		TF354250

Family and domain databases

Conserved Domains Database

More...CDDi		cd07962, Anticodon_Ia_Val, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.620, 2 hits
3.90.740.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001412, aa-tRNA-synth_I_CS
IPR002300, aa-tRNA-synth_Ia
IPR033705, Anticodon_Ia_Val
IPR013155, M/V/L/I-tRNA-synth_anticd-bd
IPR014729, Rossmann-like_a/b/a_fold
IPR009080, tRNAsynth_Ia_anticodon-bd
IPR009008, Val/Leu/Ile-tRNA-synth_edit
IPR002303, Valyl-tRNA_ligase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08264, Anticodon_1, 1 hit
PF00133, tRNA-synt_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00986, TRNASYNTHVAL

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47323, SSF47323, 1 hit
SSF50677, SSF50677, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00422, valS, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00178, AA_TRNA_LIGASE_I, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5ST30-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPHLPLASFR PPFWGLRHSR GLPRFHSVST QSEPHGSPIS RRNREAKQKR 
        60         70         80         90        100
LREKQATLEA EIAGESKSPA ESIKAWRPKE LVLYEIPTKP GEKKDVSGPL 
       110        120        130        140        150
PPAYSPRYVE AAWYPWWVRE GFFKPEYQAR LPQATGETFS MCIPPPNVTG 
       160        170        180        190        200
SLHIGHALTV AIQDALVRWH RMRGDQVLWV PGSDHAGIAT QAVVEKQLWK 
       210        220        230        240        250
ERGVRRHELS REAFLREVWQ WKEAKGGEIC EQLRALGASL DWDRECFTMD 
       260        270        280        290        300
VGSSVAVTEA FVRLYKAGLL YRNHQLVNWS CALRSAISDI EVENRPLPGH 
       310        320        330        340        350
TQLRLPGCPT PVSFGLLFSV AFPVDGEPDA EVVVGTTRPE TLPGDVAVAV 
       360        370        380        390        400
HPDDSRYTHL HGRQLRHPLM GQPLPLITDY AVQPHVGTGA VKVTPAHSPA 
       410        420        430        440        450
DAEMGARHGL SPLNVIAEDG TMTSLCGDWL QGLHRFVARE KIMSVLSEWG 
       460        470        480        490        500
LFRGLQNHPM VLPICSRSGD VIEYLLKNQW FVRCQEMGAR AAKAVESGAL 
       510        520        530        540        550
ELSPSFHQKN WQHWFSHIGD WCVSRQLWWG HQIPAYLVVE DHAQGEEDCW 
       560        570        580        590        600
VVGRSEAEAR EVAAELTGRP GAELTLERDP DVLDTWFSSA LFPFSALGWP 
       610        620        630        640        650
QETPDLARFY PLSLLETGSD LLLFWVGRMV MLGTQLTGQL PFSKVLLHPM 
       660        670        680        690        700
VRDRQGRKMS KSLGNVLDPR DIISGVEMQV LQEKLRSGNL DPAELAIVAA 
       710        720        730        740        750
AQKKDFPHGI PECGTDALRF TLCSHGVQAG DLHLSVSEVQ SCRHFCNKIW 
       760        770        780        790        800
NALRFILNAL GEKFVPQPAE ELSPSSPMDA WILSRLALAA QECERGFLTR 
       810        820        830        840        850
ELSLVTHALH HFWLHNLCDV YLEAVKPVLW HSPRPLGPPQ VLFSCADLGL 
       860        870        880        890        900
RLLAPLMPFL AEELWQRLPP RPGCPPAPSI SVAPYPSACS LEHWRQPELE 
       910        920        930        940        950
RRFSRVQEVV QVLRALRATY QLTKARPRVL LQSSEPGDQG LFEAFLEPLG 
       960        970        980        990       1000
TLGYCGAVGL LPPGAAAPSG WAQAPLSDTA QVYMELQGLV DPQIQLPLLA 
      1010       1020       1030       1040       1050
ARRYKLQKQL DSLTARTPSE GEAGTQRQQK LSSLQLELSK LDKAASHLRQ 
      1060 
LMDEPPAPGS PEL
Length:1,063
Mass (Da):118,490
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0212C6361A87DF8B
GO
Isoform 2 (identifier: Q5ST30-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: MPHLPLASFR...QLTGQLPFSK → MVFFCPVPLF...PPLLTPPCPQ

Show »
Length:501
Mass (Da):55,078
Checksum:i6F274961A95460AF
GO
Isoform 3 (identifier: Q5ST30-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.

Show »
Length:923
Mass (Da):102,416
Checksum:i2949E6A77692F99D
GO
Isoform 4 (identifier: Q5ST30-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGKAWPRRAVGTAGGPCAEQISAPFQTLLM

Show »
Length:1,093
Mass (Da):121,543
Checksum:i6CE3ECF0345D3D78
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTG1A0A0A0MTG1_HUMAN
Valyl-tRNA synthetase
VARS2
1,061Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JL52A0A0G2JL52_HUMAN
Valyl-tRNA synthetase
VARS2
1,093Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA35A0A140TA35_HUMAN
Valyl-tRNA synthetase
VARS2
1,093Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA36A0A140TA36_HUMAN
Valyl-tRNA synthetase
VARS2
1,093Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E0K6B4E0K6_HUMAN
Valyl-tRNA synthetase
VARS2
1,063Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIA5A0A0G2JIA5_HUMAN
Valyl-tRNA synthetase
VARS2
1,063Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA45A0A140TA45_HUMAN
Valyl-tRNA synthetase
VARS2
1,061Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZL25B7ZL25_HUMAN
Valyl-tRNA synthetase
VARS2
1,061Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T8Y0A0A140T8Y0_HUMAN
Valyl-tRNA synthetase
VARS2
1,063Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA40A0A140TA40_HUMAN
Valyl-tRNA synthetase
VARS2
1,061Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15191 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB67778 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAD92716 differs from that shown. The sequence differs from that shown because it seems to be derived from a pre-mRNA.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25F → S in BAG65557 (PubMed:14702039).Curated1
Sequence conflicti156H → R in BAG57195 (PubMed:14702039).Curated1
Sequence conflicti985E → G in BAB15191 (PubMed:14702039).Curated1
Sequence conflicti1060S → G in BAG65557 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05265126H → Y. Corresponds to variant dbSNP:rs6926224Ensembl.1
Natural variantiVAR_04373064G → R. Corresponds to variant dbSNP:rs6926723Ensembl.1
Natural variantiVAR_071850337T → I in COXPD20; decreased levels of the protein. 1 PublicationCorresponds to variant dbSNP:rs587777585Ensembl.1
Natural variantiVAR_071851349A → T in COXPD20. 1 PublicationCorresponds to variant dbSNP:rs587777583EnsemblClinVar.1
Natural variantiVAR_043731449W → R4 PublicationsCorresponds to variant dbSNP:rs2249464Ensembl.1
Natural variantiVAR_071852596A → D in COXPD20. 1 PublicationCorresponds to variant dbSNP:rs587777584EnsemblClinVar.1
Natural variantiVAR_043732680V → L4 PublicationsCorresponds to variant dbSNP:rs2074506Ensembl.1
Natural variantiVAR_061910765V → M. Corresponds to variant dbSNP:rs55865499Ensembl.1
Natural variantiVAR_043733917R → Q3 PublicationsCorresponds to variant dbSNP:rs9394021Ensembl.1
Natural variantiVAR_043734965A → T5 PublicationsCorresponds to variant dbSNP:rs2252863Ensembl.1
Natural variantiVAR_0437351049R → Q3 PublicationsCorresponds to variant dbSNP:rs4678Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0340321 – 644MPHLP…LPFSK → MVFFCPVPLFCPGLAPRDPR PCSFLPPVTFGNGQRPSAVL GGPHGHVGDPAHRAAALQQV WRPEIPRHLQGNPPLLTPPC PQ in isoform 2. 1 PublicationAdd BLAST644
Alternative sequenceiVSP_0454831 – 140Missing in isoform 3. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_0461021M → MGGKAWPRRAVGTAGGPCAE QISAPFQTLLM in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB067472 mRNA Translation: BAB67778.1 Different initiation.
AK025618 mRNA Translation: BAB15191.1 Different initiation.
AK125069 mRNA No translation available.
AK293780 mRNA Translation: BAG57195.1
AK304807 mRNA Translation: BAG65557.1
AB209479 Transcribed RNA Translation: BAD92716.1 Sequence problems.
AL662854 Genomic DNA No translation available.
AL669830 Genomic DNA No translation available.
AL773541 Genomic DNA No translation available.
BX927194 Genomic DNA No translation available.
CR759747 Genomic DNA No translation available.
CR936875 Genomic DNA No translation available.
BC008844 mRNA Translation: AAH08844.2
BC009355 mRNA Translation: AAH09355.2
BC073838 mRNA Translation: AAH73838.1
BC112054 mRNA Translation: AAI12055.1
BC113605 mRNA Translation: AAI13606.1
AL122037 mRNA Translation: CAB59177.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34387.1 [Q5ST30-1]
CCDS54980.1 [Q5ST30-4]
CCDS54981.1 [Q5ST30-3]

NCBI Reference Sequences

More...RefSeqi		NP_001161205.1, NM_001167733.2 [Q5ST30-3]
NP_001161206.1, NM_001167734.1 [Q5ST30-4]
NP_065175.4, NM_020442.5 [Q5ST30-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000321897; ENSP00000316092; ENSG00000137411 [Q5ST30-1]
ENST00000415079; ENSP00000400867; ENSG00000223494 [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411 [Q5ST30-1]
ENST00000546854; ENSP00000446839; ENSG00000223494 [Q5ST30-4]
ENST00000625423; ENSP00000485818; ENSG00000137411 [Q5ST30-3]
ENST00000676266; ENSP00000502585; ENSG00000137411 [Q5ST30-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		57176

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:57176

UCSC genome browser

More...UCSCi		uc003nsc.3, human [Q5ST30-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067472 mRNA Translation: BAB67778.1 Different initiation.
AK025618 mRNA Translation: BAB15191.1 Different initiation.
AK125069 mRNA No translation available.
AK293780 mRNA Translation: BAG57195.1
AK304807 mRNA Translation: BAG65557.1
AB209479 Transcribed RNA Translation: BAD92716.1 Sequence problems.
AL662854 Genomic DNA No translation available.
AL669830 Genomic DNA No translation available.
AL773541 Genomic DNA No translation available.
BX927194 Genomic DNA No translation available.
CR759747 Genomic DNA No translation available.
CR936875 Genomic DNA No translation available.
BC008844 mRNA Translation: AAH08844.2
BC009355 mRNA Translation: AAH09355.2
BC073838 mRNA Translation: AAH73838.1
BC112054 mRNA Translation: AAI12055.1
BC113605 mRNA Translation: AAI13606.1
AL122037 mRNA Translation: CAB59177.1
CCDSiCCDS34387.1 [Q5ST30-1]
CCDS54980.1 [Q5ST30-4]
CCDS54981.1 [Q5ST30-3]
RefSeqiNP_001161205.1, NM_001167733.2 [Q5ST30-3]
NP_001161206.1, NM_001167734.1 [Q5ST30-4]
NP_065175.4, NM_020442.5 [Q5ST30-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi121426, 84 interactors
IntActiQ5ST30, 17 interactors
MINTiQ5ST30
STRINGi9606.ENSP00000441000

PTM databases

iPTMnetiQ5ST30
PhosphoSitePlusiQ5ST30

Genetic variation databases

BioMutaiVARS2
DMDMi296452917

Proteomic databases

EPDiQ5ST30
jPOSTiQ5ST30
MassIVEiQ5ST30
MaxQBiQ5ST30
PaxDbiQ5ST30
PeptideAtlasiQ5ST30
PRIDEiQ5ST30
ProteomicsDBi24437
26145
63892 [Q5ST30-1]
63893 [Q5ST30-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		45126, 52 antibodies

The DNASU plasmid repository

More...DNASUi		57176

Genome annotation databases

EnsembliENST00000321897; ENSP00000316092; ENSG00000137411 [Q5ST30-1]
ENST00000415079; ENSP00000400867; ENSG00000223494 [Q5ST30-1]
ENST00000541562; ENSP00000441000; ENSG00000137411 [Q5ST30-1]
ENST00000546854; ENSP00000446839; ENSG00000223494 [Q5ST30-4]
ENST00000625423; ENSP00000485818; ENSG00000137411 [Q5ST30-3]
ENST00000676266; ENSP00000502585; ENSG00000137411 [Q5ST30-1]
GeneIDi57176
KEGGihsa:57176
UCSCiuc003nsc.3, human [Q5ST30-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		57176
DisGeNETi57176

GeneCards: human genes, protein and diseases

More...GeneCardsi		VARS2
HGNCiHGNC:21642, VARS2
HPAiENSG00000137411, Low tissue specificity
MalaCardsiVARS2
MIMi612802, gene
615917, phenotype
neXtProtiNX_Q5ST30
OpenTargetsiENSG00000137411
Orphaneti420728, Combined oxidative phosphorylation defect type 20
PharmGKBiPA164742816
VEuPathDBiHostDB:ENSG00000137411.16

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0432, Eukaryota
GeneTreeiENSGT00940000159890
InParanoidiQ5ST30
OMAiRQWYIRN
PhylomeDBiQ5ST30
TreeFamiTF354250

Enzyme and pathway databases

PathwayCommonsiQ5ST30
ReactomeiR-HSA-379726, Mitochondrial tRNA aminoacylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		57176, 394 hits in 997 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		VARS2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		57176
PharosiQ5ST30, Tbio

Protein Ontology

More...PROi		PR:Q5ST30
RNActiQ5ST30, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000137411, Expressed in right hemisphere of cerebellum and 212 other tissues
ExpressionAtlasiQ5ST30, baseline and differential
GenevisibleiQ5ST30, HS

Family and domain databases

CDDicd07962, Anticodon_Ia_Val, 1 hit
Gene3Di3.40.50.620, 2 hits
3.90.740.10, 2 hits
InterProiView protein in InterPro
IPR001412, aa-tRNA-synth_I_CS
IPR002300, aa-tRNA-synth_Ia
IPR033705, Anticodon_Ia_Val
IPR013155, M/V/L/I-tRNA-synth_anticd-bd
IPR014729, Rossmann-like_a/b/a_fold
IPR009080, tRNAsynth_Ia_anticodon-bd
IPR009008, Val/Leu/Ile-tRNA-synth_edit
IPR002303, Valyl-tRNA_ligase
PfamiView protein in Pfam
PF08264, Anticodon_1, 1 hit
PF00133, tRNA-synt_1, 1 hit
PRINTSiPR00986, TRNASYNTHVAL
SUPFAMiSSF47323, SSF47323, 1 hit
SSF50677, SSF50677, 1 hit
TIGRFAMsiTIGR00422, valS, 1 hit
PROSITEiView protein in PROSITE
PS00178, AA_TRNA_LIGASE_I, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYVM_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5ST30
Secondary accession number(s): A2ABL7
, B4DET4, B4E3P5, F5GXJ0, F5H323, Q2M2A0, Q59FI1, Q5SQ96, Q5SS98, Q6DKJ5, Q6ZV24, Q96GN2, Q96H77, Q96Q02, Q9H6R2, Q9UFH7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: June 2, 2021
This is version 159 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again