Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (16 Oct 2019)
Sequence version 2 (27 Jun 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Suppressor APC domain-containing protein 1

Gene

SAPCD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Suppressor APC domain-containing protein 1
Alternative name(s):
Protein G7d
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SAPCD1
Synonyms:C6orf26, G7D, NG23
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13938 SAPCD1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SSQ6

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
401251

Open Targets

More...
OpenTargetsi
ENSG00000228727

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134974558

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5SSQ6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SAPCD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
109829408

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002440821 – 148Suppressor APC domain-containing protein 1Add BLAST148

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SSQ6

PRoteomics IDEntifications database

More...
PRIDEi
Q5SSQ6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
63885 [Q5SSQ6-1]
63886 [Q5SSQ6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SSQ6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SSQ6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000228727 Expressed in 86 organ(s), highest expression level in skin of leg

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SSQ6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SSQ6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA071699

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
134996, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SSQ6, 11 interactors

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00500000045192

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231231

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SSQ6

Identification of Orthologs from Complete Genome Data

More...
OMAi
MCLQNLI

Database of Orthologous Groups

More...
OrthoDBi
1320161at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SSQ6

TreeFam database of animal gene trees

More...
TreeFami
TF324086

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026828 Suppressor_APCD_1/2

The PANTHER Classification System

More...
PANTHERi
PTHR14907 PTHR14907, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SSQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSQGSGGVP LVQAPYTVLL LPLGTSRQDP GAQSFFLWLR RMQALEREQD
60 70 80 90 100
ALWQGLELLQ HGQAWFEDHL REAQRQQLHL GALGENFLTD LHSEPGRPPL
110 120 130 140
AQIQKVNICL QNLIHEKELS RQQKGVTQPK EEMAQRGCTK GPRGPTRV
Length:148
Mass (Da):16,650
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6311AF525675DDFF
GO
Isoform 2 (identifier: Q5SSQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: K → KFSPSPLNKASSCTTQDSKERRREQNLWQQQ

Show »
Length:178
Mass (Da):20,183
Checksum:i32A02509CC44E793
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JH42A0A0G2JH42_HUMAN
Suppressor APC domain-containing pr...
SAPCD1
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05688930P → S. Corresponds to variant dbSNP:rs17201151Ensembl.1
Natural variantiVAR_05689099P → L. Corresponds to variant dbSNP:rs6905572Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040223117K → KFSPSPLNKASSCTTQDSKE RRREQNLWQQQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF134726 Genomic DNA Translation: AAD21821.1
BA000025 Genomic DNA Translation: BAB63305.1
AL662834 Genomic DNA No translation available.
AL662899 Genomic DNA No translation available.
BX248133 Genomic DNA No translation available.
CR759787 Genomic DNA No translation available.
CR759915 Genomic DNA No translation available.
CR925765 Genomic DNA No translation available.
BC137541 mRNA Translation: AAI37542.1
BC137542 mRNA Translation: AAI37543.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34411.1 [Q5SSQ6-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001034740.1, NM_001039651.1 [Q5SSQ6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000415669; ENSP00000411948; ENSG00000228727 [Q5SSQ6-2]
ENST00000425424; ENSP00000413372; ENSG00000228727 [Q5SSQ6-1]
ENST00000443153; ENSP00000403687; ENSG00000227074 [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861 [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918 [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951 [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176 [Q5SSQ6-2]
ENST00000547662; ENSP00000447344; ENSG00000229176 [Q5SSQ6-1]
ENST00000548987; ENSP00000448208; ENSG00000227074 [Q5SSQ6-1]
ENST00000551778; ENSP00000450257; ENSG00000234951 [Q5SSQ6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
401251

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:401251

UCSC genome browser

More...
UCSCi
uc063nhd.1 human [Q5SSQ6-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF134726 Genomic DNA Translation: AAD21821.1
BA000025 Genomic DNA Translation: BAB63305.1
AL662834 Genomic DNA No translation available.
AL662899 Genomic DNA No translation available.
BX248133 Genomic DNA No translation available.
CR759787 Genomic DNA No translation available.
CR759915 Genomic DNA No translation available.
CR925765 Genomic DNA No translation available.
BC137541 mRNA Translation: AAI37542.1
BC137542 mRNA Translation: AAI37543.1
CCDSiCCDS34411.1 [Q5SSQ6-2]
RefSeqiNP_001034740.1, NM_001039651.1 [Q5SSQ6-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi134996, 7 interactors
IntActiQ5SSQ6, 11 interactors

PTM databases

iPTMnetiQ5SSQ6
PhosphoSitePlusiQ5SSQ6

Polymorphism and mutation databases

BioMutaiSAPCD1
DMDMi109829408

Proteomic databases

jPOSTiQ5SSQ6
PRIDEiQ5SSQ6
ProteomicsDBi63885 [Q5SSQ6-1]
63886 [Q5SSQ6-2]

Genome annotation databases

EnsembliENST00000415669; ENSP00000411948; ENSG00000228727 [Q5SSQ6-2]
ENST00000425424; ENSP00000413372; ENSG00000228727 [Q5SSQ6-1]
ENST00000443153; ENSP00000403687; ENSG00000227074 [Q5SSQ6-2]
ENST00000447852; ENSP00000403346; ENSG00000227861 [Q5SSQ6-2]
ENST00000449857; ENSP00000387942; ENSG00000237918 [Q5SSQ6-2]
ENST00000453534; ENSP00000404105; ENSG00000234951 [Q5SSQ6-2]
ENST00000457185; ENSP00000405513; ENSG00000229176 [Q5SSQ6-2]
ENST00000547662; ENSP00000447344; ENSG00000229176 [Q5SSQ6-1]
ENST00000548987; ENSP00000448208; ENSG00000227074 [Q5SSQ6-1]
ENST00000551778; ENSP00000450257; ENSG00000234951 [Q5SSQ6-1]
GeneIDi401251
KEGGihsa:401251
UCSCiuc063nhd.1 human [Q5SSQ6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
401251
DisGeNETi401251

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SAPCD1
HGNCiHGNC:13938 SAPCD1
HPAiHPA071699
neXtProtiNX_Q5SSQ6
OpenTargetsiENSG00000228727
PharmGKBiPA134974558

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00500000045192
HOGENOMiHOG000231231
InParanoidiQ5SSQ6
OMAiMCLQNLI
OrthoDBi1320161at2759
PhylomeDBiQ5SSQ6
TreeFamiTF324086

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
401251
PharosiQ5SSQ6

Protein Ontology

More...
PROi
PR:Q5SSQ6

Gene expression databases

BgeeiENSG00000228727 Expressed in 86 organ(s), highest expression level in skin of leg
ExpressionAtlasiQ5SSQ6 baseline and differential
GenevisibleiQ5SSQ6 HS

Family and domain databases

InterProiView protein in InterPro
IPR026828 Suppressor_APCD_1/2
PANTHERiPTHR14907 PTHR14907, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSAPC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SSQ6
Secondary accession number(s): A2ABF2, A2ABS9, Q9Y335
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: October 16, 2019
This is version 103 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again