Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (29 Sep 2021)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Active breakpoint cluster region-related protein

Gene

Abr

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein with a unique structure having two opposing regulatory activities toward small GTP-binding proteins. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. Accelerates the intrinsic rate of GTP hydrolysis of RAC1 or CDC42, leading to down-regulation of the active GTP-bound form. The central Dbl homology (DH) domain functions as guanine nucleotide exchange factor (GEF) that modulates the GTPases CDC42, RHOA and RAC1. Promotes the conversion of CDC42, RHOA and RAC1 from the GDP-bound to the GTP-bound form (By similarity).

Functions as an important negative regulator of neuronal RAC1 activity (PubMed:20962234).

Regulates macrophage functions such as CSF-1 directed motility and phagocytosis through the modulation of RAC1 activity (PubMed:17116687).

By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-193648, NRAGE signals death through JNK
R-MMU-416482, G alpha (12/13) signalling events
R-MMU-8980692, RHOA GTPase cycle
R-MMU-9013026, RHOB GTPase cycle
R-MMU-9013106, RHOC GTPase cycle
R-MMU-9013148, CDC42 GTPase cycle
R-MMU-9013149, RAC1 GTPase cycle
R-MMU-9013404, RAC2 GTPase cycle
R-MMU-9013423, RAC3 GTPase cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Active breakpoint cluster region-related proteinCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AbrImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107771, Abr

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000017631

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cell projection, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice show impaired spatial and object recognition memory with reduced maintenance of long-term potentiation (LTP) in Schaffer collateral-CA1 pyramidal neuron synapses.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003555391 – 859Active breakpoint cluster region-related proteinAdd BLAST859

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei57PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SSL4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SSL4

PeptideAtlas

More...
PeptideAtlasi
Q5SSL4

PRoteomics IDEntifications database

More...
PRIDEi
Q5SSL4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
286021 [Q5SSL4-1]
286022 [Q5SSL4-2]
286023 [Q5SSL4-3]
286024 [Q5SSL4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SSL4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SSL4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5SSL4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In hippocampal subregions, expressed at similarly high levels in the dentate gyrus and CA1 regions, but lower in the CA3 region.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000017631, Expressed in Ammon's horn and 310 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SSL4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SSL4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DLG4.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
225161, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SSL4, 13 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000091551

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5SSL4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini91 – 284DHPROSITE-ProRule annotationAdd BLAST194
Domaini301 – 459PHPROSITE-ProRule annotationAdd BLAST159
Domaini484 – 613C2PROSITE-ProRule annotationAdd BLAST130
Domaini647 – 845Rho-GAPPROSITE-ProRule annotationAdd BLAST199

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni29 – 84DisorderedSequence analysisAdd BLAST56

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi50 – 71Polar residuesSequence analysisAdd BLAST22

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The central Dbl homology (DH) domain functions as guanine nucleotide exchange factor (GEF) that modulates the GTPases CDC42, RHOA and RAC1. Promotes the conversion of CDC42, RHOA and RAC1 from the GDP-bound to the GTP-bound form. The C-terminus is a Rho-GAP domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. The protein has a unique structure having two opposing regulatory activities toward small GTP-binding proteins.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4269, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153491

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SSL4

Identification of Orthologs from Complete Genome Data

More...
OMAi
TMFYKIP

Database of Orthologous Groups

More...
OrthoDBi
762492at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SSL4

TreeFam database of animal gene trees

More...
TreeFami
TF105082

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13366, PH_ABR, 1 hit
cd00160, RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
1.20.900.10, 1 hit
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037769, Abr/Bcr
IPR037865, ABR_PH
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR001331, GDS_CDC24_CS
IPR001849, PH_domain
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR23182, PTHR23182, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168, C2, 1 hit
PF00169, PH, 1 hit
PF00620, RhoGAP, 1 hit
PF00621, RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239, C2, 1 hit
SM00233, PH, 1 hit
SM00324, RhoGAP, 1 hit
SM00325, RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065, SSF48065, 1 hit
SSF48350, SSF48350, 1 hit
SSF49562, SSF49562, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS00741, DH_1, 1 hit
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50238, RHOGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SSL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPLSHRGLP RLSWIDTLYS NFSYGAEDYD AEGHEEQKGP PEGSETMPYI
60 70 80 90 100
DESPTMSPQL SARSQGGGDS VSPTPPEGLA PGVEAGKGLE MRKLVLSGFL
110 120 130 140 150
ASEEIYINQL EALLLPMKPL KATATTSQPV LTIQQIETIF YKIQDIYEIH
160 170 180 190 200
KEFYDNLCPK VQQWDSQVTM GHLFQKLASQ LGVYKAFVDN YKVALETAEK
210 220 230 240 250
CSQSNNQFQK ISEELKVKGP KDSKDSHTSV TMEALLYKPI DRVTRSTLVL
260 270 280 290 300
HDLLKHTPVD HPDYPLLQDA LRISQNFLSS INEDIDPRRT AVTTPKGETR
310 320 330 340 350
QLVKDGFLVE MSESSRKLRH VFLFTDVLLC AKLKKTSAGK HQQYDCKWYI
360 370 380 390 400
PLADLVFPSP EESEASPQVH PFPDHELEDM KTKISALKSE IQKEKANKGQ
410 420 430 440 450
SRAIERLKKK MFENEFLLLL NSPTIPFRIH NRNGKSYLFL LSSDYERSEW
460 470 480 490 500
REAIQKLQKK DLQAFVLSSV ELQVLTGSCF KLRTVHNIPV TSNKDDDESP
510 520 530 540 550
GLYGFLHVIV HSAKGFKQSA NLYCTLEVDS FGYFVSKAKT RVFRDTTEPK
560 570 580 590 600
WDEEFEIELE GSQSLRILCY EKCYDKTKVN KDNNEIVDKI MGKGQIQLDP
610 620 630 640 650
QTVESKNWHT DVIEMNGIKV EFSMKFTSRD MSLKRTPSKK QTGVFGVKIS
660 670 680 690 700
VVTKRERSKV PYIVRQCIEE VEKRGIEEVG IYRISGVATD IQALKAVFDA
710 720 730 740 750
NNKDILLMLS DMDINAIAGT LKLYFRELPE PLLTDRLYPA FMEGIALSDP
760 770 780 790 800
AAKENCMMHL LRSLPDPNLI TFLFLLEHLK RVAEKEPINK MSLHNLATVF
810 820 830 840 850
GPTLLRPSEV ESKAHLTSAA DIWSHDVMAQ VQVLLYYLQH PPISFAELKR

NTLYFSTDV
Length:859
Mass (Da):97,667
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i79ED2F432899A1F9
GO
Isoform 2 (identifier: Q5SSL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MEPLSHRGLPRLSWIDTLYSN → MAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSD

Show »
Length:871
Mass (Da):98,988
Checksum:iF55B406BB440733F
GO
Isoform 3 (identifier: Q5SSL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-218: Missing.
     219-233: GPKDSKDSHTSVTME → MEILLIIRFCCNCTY

Show »
Length:641
Mass (Da):73,549
Checksum:iCACCE137EDA9D9F7
GO
Isoform 4 (identifier: Q5SSL4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: MEPLSHRGLP...PTPPEGLAPG → MEEEEEAIGF...SGSPFLVAVK

Show »
Length:822
Mass (Da):93,773
Checksum:i10529465B3E4920A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A571BG95A0A571BG95_MOUSE
Active breakpoint cluster region-re...
Abr
1,185Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PUE7E9PUE7_MOUSE
Active breakpoint cluster region-re...
Abr
813Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BKT3H3BKT3_MOUSE
Active breakpoint cluster region-re...
Abr
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BL84H3BL84_MOUSE
Active breakpoint cluster region-re...
Abr
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BJY3H3BJY3_MOUSE
Active breakpoint cluster region-re...
Abr
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BKV6H3BKV6_MOUSE
Active breakpoint cluster region-re...
Abr
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAI24542 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAQ11499 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164W → R in BAE32119 (PubMed:16141072).Curated1
Sequence conflicti630D → E in BAE22375 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0359031 – 218Missing in isoform 3. 2 PublicationsAdd BLAST218
Alternative sequenceiVSP_0359041 – 82MEPLS…GLAPG → MEEEEEAIGFLDKVLEDEDV FLLEECELGTPTSPGSGSPF LVAVK in isoform 4. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_0359051 – 21MEPLS…TLYSN → MAAGGRRRRPLRYQSLAALV EDSQWPFLFLVSD in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_035906219 – 233GPKDS…SVTME → MEILLIIRFCCNCTY in isoform 3. 2 PublicationsAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK134993 mRNA Translation: BAE22375.1
AK142364 mRNA Translation: BAE25044.1
AK153615 mRNA Translation: BAE32119.1
AL591143, AL663050 Genomic DNA Translation: CAI24541.2
AL591143, AL663050 Genomic DNA Translation: CAI24542.3 Sequence problems.
AL591143, AL663050 Genomic DNA Translation: CAI24543.2
AL591143, AL663050 Genomic DNA Translation: CAI24545.1
AL591143 Genomic DNA Translation: CAI24547.2
AL663050, AL591143 Genomic DNA Translation: CAI25860.1
AL663050, AL591143 Genomic DNA Translation: CAQ11498.1
AL663050, AL591143 Genomic DNA Translation: CAQ11499.1 Sequence problems.
AL663050, AL591143 Genomic DNA Translation: CAQ11500.1
BC056385 mRNA Translation: AAH56385.1
BC058708 mRNA Translation: AAH58708.1
BC059064 mRNA Translation: AAH59064.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25066.1 [Q5SSL4-1]
CCDS36231.1 [Q5SSL4-2]
CCDS70246.1 [Q5SSL4-3]
CCDS83843.1 [Q5SSL4-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001278115.1, NM_001291186.1 [Q5SSL4-3]
NP_001333599.1, NM_001346670.1 [Q5SSL4-4]
NP_932135.1, NM_198018.2 [Q5SSL4-2]
NP_942597.1, NM_198894.2
NP_942598.1, NM_198895.2 [Q5SSL4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000065028; ENSMUSP00000068982; ENSMUSG00000017631 [Q5SSL4-3]
ENSMUST00000072740; ENSMUSP00000072522; ENSMUSG00000017631 [Q5SSL4-1]
ENSMUST00000094012; ENSMUSP00000091551; ENSMUSG00000017631 [Q5SSL4-2]
ENSMUST00000108408; ENSMUSP00000104045; ENSMUSG00000017631 [Q5SSL4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
109934

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:109934

UCSC genome browser

More...
UCSCi
uc007kfr.2, mouse [Q5SSL4-3]
uc007kfs.2, mouse [Q5SSL4-2]
uc007kft.2, mouse [Q5SSL4-1]
uc007kfv.1, mouse [Q5SSL4-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK134993 mRNA Translation: BAE22375.1
AK142364 mRNA Translation: BAE25044.1
AK153615 mRNA Translation: BAE32119.1
AL591143, AL663050 Genomic DNA Translation: CAI24541.2
AL591143, AL663050 Genomic DNA Translation: CAI24542.3 Sequence problems.
AL591143, AL663050 Genomic DNA Translation: CAI24543.2
AL591143, AL663050 Genomic DNA Translation: CAI24545.1
AL591143 Genomic DNA Translation: CAI24547.2
AL663050, AL591143 Genomic DNA Translation: CAI25860.1
AL663050, AL591143 Genomic DNA Translation: CAQ11498.1
AL663050, AL591143 Genomic DNA Translation: CAQ11499.1 Sequence problems.
AL663050, AL591143 Genomic DNA Translation: CAQ11500.1
BC056385 mRNA Translation: AAH56385.1
BC058708 mRNA Translation: AAH58708.1
BC059064 mRNA Translation: AAH59064.1
CCDSiCCDS25066.1 [Q5SSL4-1]
CCDS36231.1 [Q5SSL4-2]
CCDS70246.1 [Q5SSL4-3]
CCDS83843.1 [Q5SSL4-4]
RefSeqiNP_001278115.1, NM_001291186.1 [Q5SSL4-3]
NP_001333599.1, NM_001346670.1 [Q5SSL4-4]
NP_932135.1, NM_198018.2 [Q5SSL4-2]
NP_942597.1, NM_198894.2
NP_942598.1, NM_198895.2 [Q5SSL4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi225161, 21 interactors
IntActiQ5SSL4, 13 interactors
STRINGi10090.ENSMUSP00000091551

PTM databases

iPTMnetiQ5SSL4
PhosphoSitePlusiQ5SSL4
SwissPalmiQ5SSL4

Proteomic databases

jPOSTiQ5SSL4
PaxDbiQ5SSL4
PeptideAtlasiQ5SSL4
PRIDEiQ5SSL4
ProteomicsDBi286021 [Q5SSL4-1]
286022 [Q5SSL4-2]
286023 [Q5SSL4-3]
286024 [Q5SSL4-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22668, 75 antibodies

The DNASU plasmid repository

More...
DNASUi
109934

Genome annotation databases

EnsembliENSMUST00000065028; ENSMUSP00000068982; ENSMUSG00000017631 [Q5SSL4-3]
ENSMUST00000072740; ENSMUSP00000072522; ENSMUSG00000017631 [Q5SSL4-1]
ENSMUST00000094012; ENSMUSP00000091551; ENSMUSG00000017631 [Q5SSL4-2]
ENSMUST00000108408; ENSMUSP00000104045; ENSMUSG00000017631 [Q5SSL4-4]
GeneIDi109934
KEGGimmu:109934
UCSCiuc007kfr.2, mouse [Q5SSL4-3]
uc007kfs.2, mouse [Q5SSL4-2]
uc007kft.2, mouse [Q5SSL4-1]
uc007kfv.1, mouse [Q5SSL4-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29
MGIiMGI:107771, Abr
VEuPathDBiHostDB:ENSMUSG00000017631

Phylogenomic databases

eggNOGiKOG4269, Eukaryota
GeneTreeiENSGT00940000153491
InParanoidiQ5SSL4
OMAiTMFYKIP
OrthoDBi762492at2759
PhylomeDBiQ5SSL4
TreeFamiTF105082

Enzyme and pathway databases

ReactomeiR-MMU-193648, NRAGE signals death through JNK
R-MMU-416482, G alpha (12/13) signalling events
R-MMU-8980692, RHOA GTPase cycle
R-MMU-9013026, RHOB GTPase cycle
R-MMU-9013106, RHOC GTPase cycle
R-MMU-9013148, CDC42 GTPase cycle
R-MMU-9013149, RAC1 GTPase cycle
R-MMU-9013404, RAC2 GTPase cycle
R-MMU-9013423, RAC3 GTPase cycle

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
109934, 5 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Abr, mouse

Protein Ontology

More...
PROi
PR:Q5SSL4
RNActiQ5SSL4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000017631, Expressed in Ammon's horn and 310 other tissues
ExpressionAtlasiQ5SSL4, baseline and differential
GenevisibleiQ5SSL4, MM

Family and domain databases

CDDicd13366, PH_ABR, 1 hit
cd00160, RhoGEF, 1 hit
Gene3Di1.10.555.10, 1 hit
1.20.900.10, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR037769, Abr/Bcr
IPR037865, ABR_PH
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR001331, GDS_CDC24_CS
IPR001849, PH_domain
IPR008936, Rho_GTPase_activation_prot
IPR000198, RhoGAP_dom
PANTHERiPTHR23182, PTHR23182, 1 hit
PfamiView protein in Pfam
PF00168, C2, 1 hit
PF00169, PH, 1 hit
PF00620, RhoGAP, 1 hit
PF00621, RhoGEF, 1 hit
SMARTiView protein in SMART
SM00239, C2, 1 hit
SM00233, PH, 1 hit
SM00324, RhoGAP, 1 hit
SM00325, RhoGEF, 1 hit
SUPFAMiSSF48065, SSF48065, 1 hit
SSF48350, SSF48350, 1 hit
SSF49562, SSF49562, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS00741, DH_1, 1 hit
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50238, RHOGAP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABR_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SSL4
Secondary accession number(s): Q3U5G0
, Q3UQJ6, Q3UY38, Q5SYJ5, Q5SYJ7, Q5SYJ8, Q5SYJ9, Q6PCY1, Q6PDH3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2008
Last sequence update: December 21, 2004
Last modified: September 29, 2021
This is version 153 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again