Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (16 Oct 2019)
Sequence version 2 (29 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger ZZ-type and EF-hand domain-containing protein 1

Gene

Zzef1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri1775 – 1823ZZ-type 1PROSITE-ProRule annotationAdd BLAST49
Zinc fingeri1824 – 1870ZZ-type 2PROSITE-ProRule annotationAdd BLAST47

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger ZZ-type and EF-hand domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Zzef1
Synonyms:Kiaa0399
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2444286 Zzef1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002890012 – 2924Zinc finger ZZ-type and EF-hand domain-containing protein 1Add BLAST2923

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei240PhosphoserineBy similarity1
Modified residuei1475PhosphoserineBy similarity1
Modified residuei1488PhosphoserineCombined sources1
Modified residuei1509PhosphoserineBy similarity1
Modified residuei1510PhosphothreonineBy similarity1
Modified residuei1515PhosphoserineCombined sources1
Modified residuei1519PhosphothreonineCombined sources1
Modified residuei1521PhosphothreonineBy similarity1
Modified residuei1535PhosphoserineBy similarity1
Modified residuei1538PhosphoserineCombined sources1
Modified residuei2407PhosphoserineCombined sources1
Modified residuei2630N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SSH7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SSH7

PeptideAtlas

More...
PeptideAtlasi
Q5SSH7

PRoteomics IDEntifications database

More...
PRIDEi
Q5SSH7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SSH7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SSH7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5SSH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000055670 Expressed in 245 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SSH7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SSH7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q5SSH7, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000068790

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5SSH7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini111 – 146EF-handPROSITE-ProRule annotationAdd BLAST36
Domaini226 – 405DOCPROSITE-ProRule annotationAdd BLAST180

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1775 – 1823ZZ-type 1PROSITE-ProRule annotationAdd BLAST49
Zinc fingeri1824 – 1870ZZ-type 2PROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II3P Eukaryota
ENOG410XS5C LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155045

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000155817

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SSH7

Identification of Orthologs from Complete Genome Data

More...
OMAi
MMNVTEQ

Database of Orthologous Groups

More...
OrthoDBi
6958at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SSH7

TreeFam database of animal gene trees

More...
TreeFami
TF331572

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00051 EFh, 1 hit
cd02343 ZZ_EF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.260, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004939 APC_su10/DOC_dom
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR008979 Galactose-bd-like_sf
IPR000433 Znf_ZZ
IPR040099 ZZEF1
IPR041986 ZZEF1_ZZ

The PANTHER Classification System

More...
PANTHERi
PTHR22772:SF4 PTHR22772:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03256 ANAPC10, 1 hit
PF00569 ZZ, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01337 APC10, 1 hit
SM00054 EFh, 1 hit
SM00291 ZnF_ZZ, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF49785 SSF49785, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51284 DOC, 1 hit
PS50222 EF_HAND_2, 1 hit
PS01357 ZF_ZZ_1, 1 hit
PS50135 ZF_ZZ_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SSH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAPSNSSE DEAAAAGGEG WSPHQDWAAD SGTTPGPGPA AAVLPSAAAL
60 70 80 90 100
LEPARLREAA AALRPAPPCE SLVSRHHGAL LRWLEERLGR GEESVTLEQF
110 120 130 140 150
RELLEARGAG CSGEQFEEAF AQFDAEGDGT VDAENMLEAL KNSSGANLQG
160 170 180 190 200
ELSHVIRQLQ ACSLVPGFID IFSESKEGLG IHSSMILRFL HRNRISSMVI
210 220 230 240 250
PYPMLDHCNN MCTMRSSVLK ESLDQLVQKE KESPGDLARS PEMDKLKSVT
260 270 280 290 300
KCYAYIETSS NPADIYRMTN GETSSYWQSD GSARSHWIRL KMKPDVVLRH
310 320 330 340 350
LSIAVAATDQ SYMPQQVTVA VGRSASDLQE VRDVHIPSNV TGYVTLLENA
360 370 380 390 400
NISQLYVQIN IKRCLSDGCD TRIHGLRAVG FQRVKKSGVS VSDASAIWYW
410 420 430 440 450
SLLTSLVTAS METNPAFVQT VLHNTQKALQ HMPPLSLSPG STDFSTFLSP
460 470 480 490 500
NVLEEVDSFL IRITSCCSTP EVELTLLAFA LARGSIAKVM SSLCTITDHL
510 520 530 540 550
DTQYDASSLI SSMASVRQNL LLKYGKPLQL TLQACDVKGK EDKSGPENLL
560 570 580 590 600
VEPWTRDGFL TETGKTRAST IFSTGSDSAF QVTQIRIMVR RGGIGAQCGL
610 620 630 640 650
VFAYNSPSNK FHAEEHFKRF EKYDKWKLQE LRQFVKSRIG CSSDDLGEDD
660 670 680 690 700
PIGWFELEEE WDEADVKLQQ CRVAKFLMVK FLCTRQESAE RLGVQGLSIS
710 720 730 740 750
GYLRPARAEA EQSILYAHCR RDTENIHGAT LLLRTLQFIQ QLSHDLMQQK
760 770 780 790 800
ESGLKHKSFL DFAGLDLQIF WKFYSKLKQN RREECICAQT LLLKLLQSCF
810 820 830 840 850
SVLQGDPQAA SEEEKPTAQR SEGIQAAKEL YTHLCNVVDK PNGNSMPMEI
860 870 880 890 900
LKQEVRNTLL NGAAIFFPDR QTRRSQLFTM MKSVTEHERK QSLQLTFHSL
910 920 930 940 950
CTYFSDKDPG GLLLLPEKSD LATMNTSEVL AVMNTLLSVA ARECELLMLN
960 970 980 990 1000
RSHGAVGSVL FSLFWSVQGS LLSWCFLQLK STDAAAKELA MDLIEKYVGQ
1010 1020 1030 1040 1050
FLASMRVILE SLLSQYSGKT IVEKLCNSVF SMAARQLVIF LLDFCTLDVS
1060 1070 1080 1090 1100
HCTLLREFST LTELLKKLCS DPEGGLSKLD VETWQQEQPV VLHTWTKEST
1110 1120 1130 1140 1150
HNYENNCHEV SVFISPGATY FEVEFDERCE TEKRYDYLEF TDSRGGKTRY
1160 1170 1180 1190 1200
DTKVGTYKWP KKVTFKDGPR LQFLFHSDSS NNEWGYKFTV TAYGLPDVAV
1210 1220 1230 1240 1250
SWGLDLQLLV SRLMGRLASQ CMALKSVHQL GSNMAVSQAK LTSVLNSPLW
1260 1270 1280 1290 1300
KPVFRHQICP ELELEASWPT HPHKDGKEVK NIPDDPCRHF LLDFAQSEPA
1310 1320 1330 1340 1350
QNFCGPYSEL FKGFIQACRK QAPKTDIVAG STIDQAVNAT FAALVYRTPD
1360 1370 1380 1390 1400
LYEKLQKYVN SGGKIALTEE FSQVYSLADG IRIWMLEMKQ KSLLSLGNDS
1410 1420 1430 1440 1450
EEKRGLEAAE VNPESLAKEC IQKSLLLLKF LPMSKSSKEN CDKLETVDET
1460 1470 1480 1490 1500
DHLQPLDRRQ RTSSVVEEHF QGSASPTEAA TPAAGDRSPA LEIQPKLLPS
1510 1520 1530 1540 1550
SGPCVAEVST AEEPSPPSTP TRRPPFTRGR LRLLSFRSME ETRPVPTVKE
1560 1570 1580 1590 1600
KYPVLKDVMD FIKDQSLSHE SVVKVLSLRK AQGQSILEVL RIIQYCTESL
1610 1620 1630 1640 1650
GQPHCFHPPY ILFLLELLTC QKDFTNYFGH LEGCGADLHR EIRDTYYQLV
1660 1670 1680 1690 1700
LFLVKAIKRF SSINDRSLLP ALSCVQTALL HLLDMGWEPS DLAFFVDIQL
1710 1720 1730 1740 1750
PDLLMNMSQE NISVHDSVIS QWSEEDELAD AKQNSEWMDE CQDGMFEAWY
1760 1770 1780 1790 1800
EKIAQEDPEK QRKMHMFIAR YCDLLNVDIS CDGCDEIAPW HRYRCLQCSD
1810 1820 1830 1840 1850
MDLCKTCFLG GVKPEGHGDD HEMVNMEFTC DHCQGLIIGR RMNCNVCDDF
1860 1870 1880 1890 1900
DLCYGCYTAK KYSYGHLPTH SITAHPMVTI RISDRQRLIQ PYIHNYSWLL
1910 1920 1930 1940 1950
FAALALYSAH LTSTEQVDGE QLDPQARTNA ATLRSQCMQL VGDCLMKAHQ
1960 1970 1980 1990 2000
GKGLKALALL GVLPDGDSTS ENQALPVTVS FQASEEQADA GLLVPCNGKR
2010 2020 2030 2040 2050
AADTEVRPLD YKQKKKAGED LSIVKDPSCQ TQVSDAPASA HVPPGLPDAE
2060 2070 2080 2090 2100
HPEVSAQVLV EEKAITPNPE QVFAECSQKR ILGLLAAMLP PIKSGPTVPL
2110 2120 2130 2140 2150
IDLEHVLPLM FQVVISNAGH LNETYHLTLG LLGQLIIRLQ PAEVDAAVMK
2160 2170 2180 2190 2200
VLSAKHNLRV GLDWACSMAE ILRSLNNAPL WRDVIATFTD HCIKQLPFQL
2210 2220 2230 2240 2250
KHTNIFTLLV LVGFPQVLCV GTRCVYMDNA NEPHNVIILK HFTEKNRAVI
2260 2270 2280 2290 2300
VDVKTRKRKT VKDYQLVQKG GGQECGTSQS QLSQYSQHFA FIASHLLQTS
2310 2320 2330 2340 2350
MDSHCPEAVE ATWVLSLALK GLYKTLKAHG FEETHATFLQ TDLLKLLVKK
2360 2370 2380 2390 2400
CSKGTGFSKT WLLRDLEILS IMLYSSKKEI NTLAEHGDLE LDERGDQEEE
2410 2420 2430 2440 2450
LDRPVSSPGE AEQKKLDPLE NLDEPTRICF LMAHDALNAP LHILRAIYEL
2460 2470 2480 2490 2500
QMKKTDSFFL EVQKRFDGDE LTTDERIRSL AQRWQPSRSL RLEEQSAKAV
2510 2520 2530 2540 2550
DTDMIILPCL SRPARSDQAT PESNPVTQKL ISSTESELQQ SYAKQRRSKS
2560 2570 2580 2590 2600
AALLHKELNC KSKRAIRDYL FRVNEATSVL YARHVLASLL AEWPGHVPVS
2610 2620 2630 2640 2650
EDILELSGPA HMTYILDMFM QLEEKHQWEK ILQKVLQGCR ENMLGTMALA
2660 2670 2680 2690 2700
ACQFMEEPGM EVQVRESKHS YNNNTSFEDK VHIPGAIYLS IKFDPQRNTE
2710 2720 2730 2740 2750
EGCDELAMSS SSDFQQDRHN FSGSQQKWKD FELPGDTLYY RFTSDMSNTE
2760 2770 2780 2790 2800
WGYRFTVTAG HLGRFQTGFE ILKQMLSEER VVPHLALGKI WEWLVGVACR
2810 2820 2830 2840 2850
QTGHQRLKAI HLLLRIVQCC SHSDLCDLGL LKPLWQLFTH MEYGLFEDVT
2860 2870 2880 2890 2900
QPGILLPLHR ALTELFFVTE NRAQELGLLQ EYLLALTTED HLLRCAAQAL
2910 2920
QNIAAISLAI NYPNKATRLW NVEC
Length:2,924
Mass (Da):328,312
Last modified:May 29, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i35E1B0C9981C4B78
GO
Isoform 2 (identifier: Q5SSH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2664-2697: VRESKHSYNNNTSFEDKVHIPGAIYLSIKFDPQR → C

Note: No experimental confirmation available.
Show »
Length:2,891
Mass (Da):324,442
Checksum:i903BB19A7595521D
GO
Isoform 3 (identifier: Q5SSH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2840: Missing.

Note: No experimental confirmation available.
Show »
Length:84
Mass (Da):9,515
Checksum:iD320A37E3B98BD4B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A140LJ04A0A140LJ04_MOUSE
Zinc finger ZZ-type and EF-hand dom...
Zzef1
2,953Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q5W5E9Q5W5_MOUSE
Zinc finger ZZ-type and EF-hand dom...
Zzef1
2,924Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH37463 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH99976 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC97941 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2670S → P in BAC35122 (PubMed:16141072).Curated1
Sequence conflicti2697R → C in BAC35122 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258771 – 2840Missing in isoform 3. 1 PublicationAdd BLAST2840
Alternative sequenceiVSP_0258762664 – 2697VRESK…FDPQR → C in isoform 2. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129131 mRNA Translation: BAC97941.1 Different initiation.
AL663082 Genomic DNA No translation available.
BC037463 mRNA Translation: AAH37463.1 Different initiation.
BC099976 mRNA Translation: AAH99976.1 Different initiation.
AK052734 mRNA Translation: BAC35122.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36218.1 [Q5SSH7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001039001.1, NM_001045536.2 [Q5SSH7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000069395; ENSMUSP00000068790; ENSMUSG00000055670 [Q5SSH7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
195018

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:195018

UCSC genome browser

More...
UCSCi
uc007jzl.2 mouse [Q5SSH7-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129131 mRNA Translation: BAC97941.1 Different initiation.
AL663082 Genomic DNA No translation available.
BC037463 mRNA Translation: AAH37463.1 Different initiation.
BC099976 mRNA Translation: AAH99976.1 Different initiation.
AK052734 mRNA Translation: BAC35122.1
CCDSiCCDS36218.1 [Q5SSH7-2]
RefSeqiNP_001039001.1, NM_001045536.2 [Q5SSH7-2]

3D structure databases

SMRiQ5SSH7
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ5SSH7, 3 interactors
STRINGi10090.ENSMUSP00000068790

PTM databases

iPTMnetiQ5SSH7
PhosphoSitePlusiQ5SSH7
SwissPalmiQ5SSH7

Proteomic databases

jPOSTiQ5SSH7
PaxDbiQ5SSH7
PeptideAtlasiQ5SSH7
PRIDEiQ5SSH7

Genome annotation databases

EnsembliENSMUST00000069395; ENSMUSP00000068790; ENSMUSG00000055670 [Q5SSH7-2]
GeneIDi195018
KEGGimmu:195018
UCSCiuc007jzl.2 mouse [Q5SSH7-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23140
MGIiMGI:2444286 Zzef1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410II3P Eukaryota
ENOG410XS5C LUCA
GeneTreeiENSGT00940000155045
HOGENOMiHOG000155817
InParanoidiQ5SSH7
OMAiMMNVTEQ
OrthoDBi6958at2759
PhylomeDBiQ5SSH7
TreeFamiTF331572

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zzef1 mouse

Protein Ontology

More...
PROi
PR:Q5SSH7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000055670 Expressed in 245 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ5SSH7 baseline and differential
GenevisibleiQ5SSH7 MM

Family and domain databases

CDDicd00051 EFh, 1 hit
cd02343 ZZ_EF, 1 hit
Gene3Di2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR004939 APC_su10/DOC_dom
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR008979 Galactose-bd-like_sf
IPR000433 Znf_ZZ
IPR040099 ZZEF1
IPR041986 ZZEF1_ZZ
PANTHERiPTHR22772:SF4 PTHR22772:SF4, 1 hit
PfamiView protein in Pfam
PF03256 ANAPC10, 1 hit
PF00569 ZZ, 2 hits
SMARTiView protein in SMART
SM01337 APC10, 1 hit
SM00054 EFh, 1 hit
SM00291 ZnF_ZZ, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF49785 SSF49785, 1 hit
PROSITEiView protein in PROSITE
PS51284 DOC, 1 hit
PS50222 EF_HAND_2, 1 hit
PS01357 ZF_ZZ_1, 1 hit
PS50135 ZF_ZZ_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZZEF1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SSH7
Secondary accession number(s): Q499C8
, Q6ZQC5, Q8C710, Q8CI54
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: October 16, 2019
This is version 113 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again