Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testis-expressed basic protein 1

Gene

TSBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Testis-expressed basic protein 1Curated
Alternative name(s):
Uncharacterized protein C6orf10Curated
Gene namesi
Name:TSBP1Imported
Synonyms:C6orf10Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204296.11
HGNCiHGNC:13922 TSBP1
neXtProtiNX_Q5SRN2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei3 – 23HelicalSequence analysisAdd BLAST21
Transmembranei99 – 119HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10665
OpenTargetsiENSG00000204296
PharmGKBiPA25923

Polymorphism and mutation databases

BioMutaiC6orf10
DMDMi317373458

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000895031 – 563Testis-expressed basic protein 1Add BLAST563

Proteomic databases

PaxDbiQ5SRN2
PeptideAtlasiQ5SRN2
PRIDEiQ5SRN2
ProteomicsDBi63857
63858 [Q5SRN2-2]

PTM databases

iPTMnetiQ5SRN2
PhosphoSitePlusiQ5SRN2

Expressioni

Gene expression databases

BgeeiENSG00000204296 Expressed in 39 organ(s), highest expression level in testis
CleanExiHS_C6orf10
ExpressionAtlasiQ5SRN2 baseline and differential
GenevisibleiQ5SRN2 HS

Interactioni

Protein-protein interaction databases

BioGridi115907, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliQ5SRN2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi474 – 560Lys-richAdd BLAST87

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J4K6 Eukaryota
ENOG4111AWZ LUCA
GeneTreeiENSGT00530000064839
HOVERGENiHBG053844
InParanoidiQ5SRN2
PhylomeDBiQ5SRN2
TreeFamiTF342352

Family and domain databases

InterProiView protein in InterPro
IPR038754 C6orf10
PANTHERiPTHR14368 PTHR14368, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 24 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SRN2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTVLEITLAV ILTLLGLAIL AILLTRWARC KQSEMYISRY SSEQSARLLD
60 70 80 90 100
YEDGRGSRHA YSTQSDTSYD NRERSKRDYT PSTNSLVSMA SKFSLGQTEL
110 120 130 140 150
ILLLMCFILA LSRSSIGSIK CLQTTEEPPS RTAGAMMQFT APIPGATGPI
160 170 180 190 200
KLSQKTIVQT PGPIVQYPGS NAGPPSAPRG PPMAPIIISQ RTARIPQVHT
210 220 230 240 250
MDSSGKITLT PVVILTGYMD EELAKKSCSK IQILKCGGTA RSQNSREENK
260 270 280 290 300
EALKNDIIFT NSVESLKSAH IKEPEREGKG TDLEKDKIGM EVKVDSDAGI
310 320 330 340 350
PKRQETQLKI SEMSIPQGQG AQIKKSVSDV PRGQESQVKK SESGVPKGQE
360 370 380 390 400
AQVTKSGLVV LKGQEAQVEK SEMGVPRRQE SQVKKSQSGV SKGQEAQVKK
410 420 430 440 450
RESVVLKGQE AQVEKSELKV PKGQEGQVEK TEADVPKEQE VQEKKSEAGV
460 470 480 490 500
LKGPESQVKN TEVSVPETLE SQVKKSESGV LKGQEAQEKK ESFEDKGNND
510 520 530 540 550
KEKERDAEKD PNKKEKGDKN TKGDKGKDKV KGKRESEING EKSKGSKRAK
560
ANTGRKYNKK VEE
Length:563
Mass (Da):61,626
Last modified:January 11, 2011 - v3
Checksum:iD5A75E4624FD2E6E
GO
Isoform 2 (identifier: Q5SRN2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-117: VSMASKFSLGQTELILLLMCFILALSRSSIG → ALSRSSIALPQGSMS
     172-172: A → VRSHPHTIT
     193-193: A → ASQLAAPI

Note: No experimental confirmation available.
Show »
Length:562
Mass (Da):61,440
Checksum:iFACF12187A203A88
GO
Isoform 3 (identifier: Q5SRN2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-117: VSMASKFSLGQTELILLLMCFILALSRSSIG → ALSRSSIALPQGSMS
     193-193: A → ASQLAAPIIISQRTA

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:561
Mass (Da):61,251
Checksum:i7C0BB8424CF779EF
GO

Computationally mapped potential isoform sequencesi

There are 24 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQ85E9PQ85_HUMAN
Testis-expressed basic protein 1
TSBP1
125Annotation score:
E9PLW3E9PLW3_HUMAN
Testis-expressed basic protein 1
TSBP1
547Annotation score:
C9J9T8C9J9T8_HUMAN
Testis-expressed basic protein 1
TSBP1
468Annotation score:
E9PNQ4E9PNQ4_HUMAN
Testis-expressed basic protein 1
TSBP1
132Annotation score:
F8VVU2F8VVU2_HUMAN
Testis-expressed basic protein 1
TSBP1
561Annotation score:
A0A0G2JN18A0A0G2JN18_HUMAN
Testis-expressed basic protein 1
TSBP1
565Annotation score:
A0A0G2JQ19A0A0G2JQ19_HUMAN
Testis-expressed basic protein 1
TSBP1
566Annotation score:
A0A0G2JMA0A0A0G2JMA0_HUMAN
Testis-expressed basic protein 1
TSBP1
547Annotation score:
A0A0G2JML4A0A0G2JML4_HUMAN
Testis-expressed basic protein 1
TSBP1
547Annotation score:
A0A0G2JNW1A0A0G2JNW1_HUMAN
Testis-expressed basic protein 1
TSBP1
566Annotation score:
There are more potential isoformsShow all

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02287530C → R2 PublicationsCorresponds to variant dbSNP:rs3129941Ensembl.1
Natural variantiVAR_02287636Y → H2 PublicationsCorresponds to variant dbSNP:rs9268384Ensembl.1
Natural variantiVAR_02287769Y → C2 PublicationsCorresponds to variant dbSNP:rs9268368Ensembl.1
Natural variantiVAR_022878128P → L2 PublicationsCorresponds to variant dbSNP:rs1033500Ensembl.1
Natural variantiVAR_022879150I → F1 PublicationCorresponds to variant dbSNP:rs1265754Ensembl.1
Natural variantiVAR_033068161P → L1 PublicationCorresponds to variant dbSNP:rs1003878Ensembl.1
Natural variantiVAR_022880170S → P2 PublicationsCorresponds to variant dbSNP:rs9405090Ensembl.1
Natural variantiVAR_022881227S → P2 PublicationsCorresponds to variant dbSNP:rs560505Ensembl.1
Natural variantiVAR_056793266L → W. Corresponds to variant dbSNP:rs4947338Ensembl.1
Natural variantiVAR_056794274P → S. Corresponds to variant dbSNP:rs34498363Ensembl.1
Natural variantiVAR_022882315I → V1 PublicationCorresponds to variant dbSNP:rs3749966Ensembl.1
Natural variantiVAR_022883400K → Q1 PublicationCorresponds to variant dbSNP:rs7775397Ensembl.1
Natural variantiVAR_056795433A → T. Corresponds to variant dbSNP:rs16870005Ensembl.1
Natural variantiVAR_056796479G → V. Corresponds to variant dbSNP:rs7751028Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01464587 – 117VSMAS…RSSIG → ALSRSSIALPQGSMS in isoform 2 and isoform 3. CuratedAdd BLAST31
Alternative sequenceiVSP_014646172A → VRSHPHTIT in isoform 2. Curated1
Alternative sequenceiVSP_014647193A → ASQLAAPI in isoform 2. Curated1
Alternative sequenceiVSP_055702193A → ASQLAAPIIISQRTA in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL034394, AL035445 Genomic DNA Translation: CAI42178.1
AL034394, AL035445 Genomic DNA Translation: CAI42179.1
AL035445, AL034394 Genomic DNA Translation: CAI20345.1
AL035445, AL034394 Genomic DNA Translation: CAI20346.1
AL662796 Genomic DNA No translation available.
AL670296 Genomic DNA No translation available.
AL845557 Genomic DNA No translation available.
AL671511 Genomic DNA No translation available.
AL845509 Genomic DNA No translation available.
BX001039 Genomic DNA No translation available.
BX119999 Genomic DNA No translation available.
BX255945 Genomic DNA No translation available.
BX284927 Genomic DNA No translation available.
BX908732 Genomic DNA No translation available.
BX927180 Genomic DNA No translation available.
BC034774 mRNA Translation: AAH34774.1
CCDSiCCDS34422.1 [Q5SRN2-1]
CCDS69082.1 [Q5SRN2-3]
RefSeqiNP_001273403.1, NM_001286474.1 [Q5SRN2-3]
NP_001273404.1, NM_001286475.1
NP_006772.3, NM_006781.4 [Q5SRN2-1]
UniGeneiHs.567414

Genome annotation databases

EnsembliENST00000375015; ENSP00000364155; ENSG00000204296 [Q5SRN2-2]
ENST00000383130; ENSP00000372611; ENSG00000206245 [Q5SRN2-1]
ENST00000399749; ENSP00000382654; ENSG00000206310
ENST00000447241; ENSP00000415517; ENSG00000204296 [Q5SRN2-1]
ENST00000448986; ENSP00000410514; ENSG00000206245 [Q5SRN2-2]
ENST00000457429; ENSP00000408514; ENSG00000232106
ENST00000533191; ENSP00000431199; ENSG00000204296 [Q5SRN2-3]
ENST00000548927; ENSP00000448472; ENSG00000206245 [Q5SRN2-3]
ENST00000612031; ENSP00000480403; ENSG00000204296 [Q5SRN2-1]
ENST00000618584; ENSP00000485011; ENSG00000206245 [Q5SRN2-1]
GeneIDi10665
KEGGihsa:10665
UCSCiuc011jsa.4 human [Q5SRN2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL034394, AL035445 Genomic DNA Translation: CAI42178.1
AL034394, AL035445 Genomic DNA Translation: CAI42179.1
AL035445, AL034394 Genomic DNA Translation: CAI20345.1
AL035445, AL034394 Genomic DNA Translation: CAI20346.1
AL662796 Genomic DNA No translation available.
AL670296 Genomic DNA No translation available.
AL845557 Genomic DNA No translation available.
AL671511 Genomic DNA No translation available.
AL845509 Genomic DNA No translation available.
BX001039 Genomic DNA No translation available.
BX119999 Genomic DNA No translation available.
BX255945 Genomic DNA No translation available.
BX284927 Genomic DNA No translation available.
BX908732 Genomic DNA No translation available.
BX927180 Genomic DNA No translation available.
BC034774 mRNA Translation: AAH34774.1
CCDSiCCDS34422.1 [Q5SRN2-1]
CCDS69082.1 [Q5SRN2-3]
RefSeqiNP_001273403.1, NM_001286474.1 [Q5SRN2-3]
NP_001273404.1, NM_001286475.1
NP_006772.3, NM_006781.4 [Q5SRN2-1]
UniGeneiHs.567414

3D structure databases

ProteinModelPortaliQ5SRN2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115907, 2 interactors

PTM databases

iPTMnetiQ5SRN2
PhosphoSitePlusiQ5SRN2

Polymorphism and mutation databases

BioMutaiC6orf10
DMDMi317373458

Proteomic databases

PaxDbiQ5SRN2
PeptideAtlasiQ5SRN2
PRIDEiQ5SRN2
ProteomicsDBi63857
63858 [Q5SRN2-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375015; ENSP00000364155; ENSG00000204296 [Q5SRN2-2]
ENST00000383130; ENSP00000372611; ENSG00000206245 [Q5SRN2-1]
ENST00000399749; ENSP00000382654; ENSG00000206310
ENST00000447241; ENSP00000415517; ENSG00000204296 [Q5SRN2-1]
ENST00000448986; ENSP00000410514; ENSG00000206245 [Q5SRN2-2]
ENST00000457429; ENSP00000408514; ENSG00000232106
ENST00000533191; ENSP00000431199; ENSG00000204296 [Q5SRN2-3]
ENST00000548927; ENSP00000448472; ENSG00000206245 [Q5SRN2-3]
ENST00000612031; ENSP00000480403; ENSG00000204296 [Q5SRN2-1]
ENST00000618584; ENSP00000485011; ENSG00000206245 [Q5SRN2-1]
GeneIDi10665
KEGGihsa:10665
UCSCiuc011jsa.4 human [Q5SRN2-1]

Organism-specific databases

CTDi10665
DisGeNETi10665
EuPathDBiHostDB:ENSG00000204296.11
GeneCardsiC6orf10
H-InvDBiHIX0025079
HIX0166455
HIX0166691
HIX0167216
HIX0167417
HGNCiHGNC:13922 TSBP1
neXtProtiNX_Q5SRN2
OpenTargetsiENSG00000204296
PharmGKBiPA25923
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J4K6 Eukaryota
ENOG4111AWZ LUCA
GeneTreeiENSGT00530000064839
HOVERGENiHBG053844
InParanoidiQ5SRN2
PhylomeDBiQ5SRN2
TreeFamiTF342352

Miscellaneous databases

ChiTaRSiC6orf10 human
GeneWikiiC6orf10
GenomeRNAii10665
PROiPR:Q5SRN2

Gene expression databases

BgeeiENSG00000204296 Expressed in 39 organ(s), highest expression level in testis
CleanExiHS_C6orf10
ExpressionAtlasiQ5SRN2 baseline and differential
GenevisibleiQ5SRN2 HS

Family and domain databases

InterProiView protein in InterPro
IPR038754 C6orf10
PANTHERiPTHR14368 PTHR14368, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTSBP1_HUMAN
AccessioniPrimary (citable) accession number: Q5SRN2
Secondary accession number(s): A2BET1
, A2BET2, A6NME2, B0S7R2, B0S7R3, E9PMB1, Q5SPI9, Q5SPJ0, Q5SPK9, Q5SPL0, Q5SRN3, Q5TG25, Q5TG26, Q8N4B6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 11, 2011
Last modified: November 7, 2018
This is version 112 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again