Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (07 Apr 2021)
Sequence version 3 (26 May 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Hippocampus abundant transcript-like protein 1

Gene

MFSD14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5SR56

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.2.30, the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hippocampus abundant transcript-like protein 1Imported
Alternative name(s):
Major facilitator superfamily domain-containing 14BImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MFSD14BImported
Synonyms:HIATL1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23376, MFSD14B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SR56

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000148110.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 49ExtracellularSequence analysisAdd BLAST49
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei50 – 70HelicalSequence analysisAdd BLAST21
Topological domaini71 – 82CytoplasmicSequence analysisAdd BLAST12
Transmembranei83 – 103HelicalSequence analysisAdd BLAST21
Topological domaini104 – 111ExtracellularSequence analysis8
Transmembranei112 – 132HelicalSequence analysisAdd BLAST21
Topological domaini133 – 134CytoplasmicSequence analysis2
Transmembranei135 – 155HelicalSequence analysisAdd BLAST21
Topological domaini156 – 168ExtracellularSequence analysisAdd BLAST13
Transmembranei169 – 189HelicalSequence analysisAdd BLAST21
Topological domaini190 – 196CytoplasmicSequence analysis7
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 255ExtracellularSequence analysisAdd BLAST38
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 281CytoplasmicSequence analysis5
Transmembranei282 – 302HelicalSequence analysisAdd BLAST21
Topological domaini303 – 319ExtracellularSequence analysisAdd BLAST17
Transmembranei320 – 340HelicalSequence analysisAdd BLAST21
Topological domaini341CytoplasmicSequence analysis1
Transmembranei342 – 362HelicalSequence analysisAdd BLAST21
Topological domaini363 – 387ExtracellularSequence analysisAdd BLAST25
Transmembranei388 – 408HelicalSequence analysisAdd BLAST21
Topological domaini409 – 428CytoplasmicSequence analysisAdd BLAST20
Transmembranei429 – 449HelicalSequence analysisAdd BLAST21
Topological domaini450 – 506ExtracellularSequence analysisAdd BLAST57

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84641

Open Targets

More...
OpenTargetsi
ENSG00000148110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671691

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5SR56, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MFSD14B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054382

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002392291 – 506Hippocampus abundant transcript-like protein 1Add BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi463N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5SR56

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SR56

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5SR56

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5SR56

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SR56

PeptideAtlas

More...
PeptideAtlasi
Q5SR56

PRoteomics IDEntifications database

More...
PRIDEi
Q5SR56

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5181
63839 [Q5SR56-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q5SR56, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SR56

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SR56

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148110, Expressed in oviduct epithelium and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SR56, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SR56, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000148110, Tissue enhanced (parathyroid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q5SR56
With#Exp.IntAct
ADIPOQ [Q15848]3EBI-373355,EBI-10827839
AGPAT3 [Q9NRZ7]3EBI-373355,EBI-2803601
AGPAT4 [Q9NRZ5]3EBI-373355,EBI-1754287
ARL6IP1 [Q15041]3EBI-373355,EBI-714543
ATP13A1 - isoform C [Q9HD20-3]3EBI-373355,EBI-12069500
BNIP3 [Q12983]3EBI-373355,EBI-749464
C4orf3 - isoform 2 [Q8WVX3-2]3EBI-373355,EBI-12003442
CCL4L2 [Q8NHW4]3EBI-373355,EBI-10271156
CFHR5 [Q9BXR6]3EBI-373355,EBI-11579371
CLDN4 [O14493]3EBI-373355,EBI-9316372
CMTM3 [Q96MX0]3EBI-373355,EBI-7247651
COMT [P21964]3EBI-373355,EBI-372265
CSGALNACT2 [Q8N6G5]3EBI-373355,EBI-10267100
CYB5B [O43169]3EBI-373355,EBI-1058710
CYBC1 [Q9BQA9]3EBI-373355,EBI-2680384
DEFB127 [Q9H1M4]3EBI-373355,EBI-10305240
DNAJC30 [Q96LL9]3EBI-373355,EBI-8639143
EMC6 [Q9BV81]3EBI-373355,EBI-2820492
ERG28 [Q9UKR5]3EBI-373355,EBI-711490
FKBP8 [Q14318]3EBI-373355,EBI-724839
FMO1 [Q01740]3EBI-373355,EBI-12701460
FUNDC2 [Q9BWH2]3EBI-373355,EBI-714482
GIMAP1 [Q8WWP7]3EBI-373355,EBI-11991950
GOSR2 [O14653]3EBI-373355,EBI-4401517
GRM2 [Q14416]3EBI-373355,EBI-10232876
KTN1 - isoform 3 [Q86UP2-3]3EBI-373355,EBI-12007212
LAT - isoform 2 [O43561-2]3EBI-373355,EBI-8070286
LEPROTL1 [O95214]3EBI-373355,EBI-750776
LPCAT2 [Q7L5N7]3EBI-373355,EBI-4280011
LRP10 [Q7Z4F1]3EBI-373355,EBI-2830349
MGLL [A0A0C4DFN3]3EBI-373355,EBI-12866138
MS4A1 [P11836]3EBI-373355,EBI-2808234
NAT8 [Q9UHE5]3EBI-373355,EBI-2863634
NRAC [Q8N912]3EBI-373355,EBI-12051377
ORMDL1 [Q9P0S3]3EBI-373355,EBI-1054848
PEX16 [Q9Y5Y5]3EBI-373355,EBI-981985
PKMYT1 - isoform 2 [Q99640-2]3EBI-373355,EBI-12257782
PPGB [Q59EV6]3EBI-373355,EBI-14210385
PRRT2 [Q7Z6L0]3EBI-373355,EBI-722696
RNF24 - isoform 2 [Q9Y225-2]3EBI-373355,EBI-13044680
SACM1L [Q9NTJ5]3EBI-373355,EBI-3917235
SCD [O00767]3EBI-373355,EBI-2684237
SERP1 [Q9Y6X1]3EBI-373355,EBI-10329948
SERP2 [Q8N6R1]3EBI-373355,EBI-749270
SLC25A46 [Q96AG3]3EBI-373355,EBI-10281975
SLC39A9 [Q9NUM3]3EBI-373355,EBI-2823239
SLC66A2 [Q8N2U9]3EBI-373355,EBI-3907610
SMAGP [Q0VAQ4]3EBI-373355,EBI-10226799
STX3 [Q13277]3EBI-373355,EBI-1394295
TECR [Q9NZ01]3EBI-373355,EBI-2877718
THSD7B [C9JKN6]3EBI-373355,EBI-17192156
TIMMDC1 [Q9NPL8]3EBI-373355,EBI-6268651
TMBIM6 [P55061]3EBI-373355,EBI-1045825
TMEM167B [Q9NRX6]3EBI-373355,EBI-17684533
TMEM176A [Q96HP8]3EBI-373355,EBI-2800645
TMEM19 [Q96HH6]3EBI-373355,EBI-741829
TMEM208 [Q9BTX3]3EBI-373355,EBI-12876824
TMEM229B [Q8NBD8]3EBI-373355,EBI-12195227
TMEM239 - isoform 2 [Q8WW34-2]3EBI-373355,EBI-11528917
TMX2 [Q9Y320]3EBI-373355,EBI-6447886
TPRG1 [Q6ZUI0]3EBI-373355,EBI-17249488
TREX1 - isoform 1 [Q9NSU2-1]3EBI-373355,EBI-16746122
TSNARE1 [A0AVG3]3EBI-373355,EBI-12003468
TUSC5 [A5PKU2]3EBI-373355,EBI-11988865
UBE2J1 [Q9Y385]3EBI-373355,EBI-988826
UNC50 [Q53HI1]3EBI-373355,EBI-7601760
USE1 [Q9NZ43]3EBI-373355,EBI-742842
YIPF1 [Q9Y548]3EBI-373355,EBI-7850136
YIPF2 [Q9BWQ6]3EBI-373355,EBI-751204
YIPF4 [Q9BSR8]3EBI-373355,EBI-751253
YIPF6 [Q96EC8]3EBI-373355,EBI-751210
ZDHHC24 [Q6UX98]3EBI-373355,EBI-10254561
ZFPL1 [O95159]3EBI-373355,EBI-718439

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124166, 78 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SR56, 74 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364493

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5SR56, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the major facilitator superfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2816, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156081

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001265_10_5_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SR56

Identification of Orthologs from Complete Genome Data

More...
OMAi
LMRINPW

Database of Orthologous Groups

More...
OrthoDBi
763423at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SR56

TreeFam database of animal gene trees

More...
TreeFami
TF313511

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011701, MFS
IPR020846, MFS_dom
IPR036259, MFS_trans_sf
IPR005829, Sugar_transporter_CS
IPR001958, Tet-R_TetA/multi-R_MdtG

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07690, MFS_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01035, TCRTETA

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473, SSF103473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SR56-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVEPPPELE EKAASEPEAG AMPEKRAGAQ AAGSTWLQGF GRPSVYHAAI
60 70 80 90 100
VIFLEFFAWG LLTTPMLTVL HETFSQHTFL MNGLIQGVKG LLSFLSAPLI
110 120 130 140 150
GALSDVWGRK PFLLGTVFFT CFPIPLMRIS PWWYFAMISV SGVFSVTFSV
160 170 180 190 200
IFAYVADVTQ EHERSTAYGW VSATFAASLV SSPAIGAYLS ASYGDSLVVL
210 220 230 240 250
VATVVALLDI CFILVAVPES LPEKMRPVSW GAQISWKQAD PFASLKKVGK
260 270 280 290 300
DSTVLLICIT VFLSYLPEAG QYSSFFLYLR QVIGFGSVKI AAFIAMVGIL
310 320 330 340 350
SIVAQTAFLS ILMRSLGNKN TVLLGLGFQM LQLAWYGFGS QAWMMWAAGT
360 370 380 390 400
VAAMSSITFP AISALVSRNA ESDQQGVAQG IITGIRGLCN GLGPALYGFI
410 420 430 440 450
FYMFHVELTE LGPKLNSNNV PLQGAVIPGP PFLFGACIVL MSFLVALFIP
460 470 480 490 500
EYSKASGVQK HSNSSSGSLT NTPERGSDED IEPLLQDSSI WELSSFEEPG

NQCTEL
Length:506
Mass (Da):54,545
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CD09B8A06EC6EA5
GO
Isoform 2 (identifier: Q5SR56-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     344-376: MMWAAGTVAAMSSITFPAISALVSRNAESDQQG → SCPGDHNWNKRTMQWPGASTVWLHILHVPCGTD
     377-506: Missing.

Show »
Length:311
Mass (Da):34,048
Checksum:i8E5B8B10308D4ACF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSX1A0A0A0MSX1_HUMAN
Hippocampus abundant transcript-lik...
MFSD14B
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI06063 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55274 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD96556 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti367S → T in BAB55274 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055401406V → L1 PublicationCorresponds to variant dbSNP:rs17851857Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566921 – 65Missing in isoform 2. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_056693344 – 376MMWAA…SDQQG → SCPGDHNWNKRTMQWPGAST VWLHILHVPCGTD in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_056694377 – 506Missing in isoform 2. 1 PublicationAdd BLAST130

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027659 mRNA Translation: BAB55274.1 Different initiation.
AK300615 mRNA Translation: BAG62308.1
AL358232 Genomic DNA No translation available.
AL691447 Genomic DNA No translation available.
BC106062 mRNA Translation: AAI06063.1 Different initiation.
BC021093 mRNA Translation: AAH21093.2
AK222836 mRNA Translation: BAD96556.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6710.2 [Q5SR56-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115947.2, NM_032558.2 [Q5SR56-1]
XP_016870710.1, XM_017015221.1 [Q5SR56-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375344; ENSP00000364493; ENSG00000148110 [Q5SR56-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84641

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84641

UCSC genome browser

More...
UCSCi
uc004aur.4, human [Q5SR56-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA Translation: BAB55274.1 Different initiation.
AK300615 mRNA Translation: BAG62308.1
AL358232 Genomic DNA No translation available.
AL691447 Genomic DNA No translation available.
BC106062 mRNA Translation: AAI06063.1 Different initiation.
BC021093 mRNA Translation: AAH21093.2
AK222836 mRNA Translation: BAD96556.1 Different initiation.
CCDSiCCDS6710.2 [Q5SR56-1]
RefSeqiNP_115947.2, NM_032558.2 [Q5SR56-1]
XP_016870710.1, XM_017015221.1 [Q5SR56-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124166, 78 interactors
IntActiQ5SR56, 74 interactors
STRINGi9606.ENSP00000364493

Protein family/group databases

TCDBi2.A.1.2.30, the major facilitator superfamily (mfs)

PTM databases

GlyGeniQ5SR56, 1 site
iPTMnetiQ5SR56
PhosphoSitePlusiQ5SR56

Genetic variation databases

BioMutaiMFSD14B
DMDMi238054382

Proteomic databases

EPDiQ5SR56
jPOSTiQ5SR56
MassIVEiQ5SR56
MaxQBiQ5SR56
PaxDbiQ5SR56
PeptideAtlasiQ5SR56
PRIDEiQ5SR56
ProteomicsDBi5181
63839 [Q5SR56-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3023, 55 antibodies

The DNASU plasmid repository

More...
DNASUi
84641

Genome annotation databases

EnsembliENST00000375344; ENSP00000364493; ENSG00000148110 [Q5SR56-1]
GeneIDi84641
KEGGihsa:84641
UCSCiuc004aur.4, human [Q5SR56-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84641
DisGeNETi84641

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MFSD14B
HGNCiHGNC:23376, MFSD14B
HPAiENSG00000148110, Tissue enhanced (parathyroid)
neXtProtiNX_Q5SR56
OpenTargetsiENSG00000148110
PharmGKBiPA142671691
VEuPathDBiHostDB:ENSG00000148110.15

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2816, Eukaryota
GeneTreeiENSGT00940000156081
HOGENOMiCLU_001265_10_5_1
InParanoidiQ5SR56
OMAiLMRINPW
OrthoDBi763423at2759
PhylomeDBiQ5SR56
TreeFamiTF313511

Enzyme and pathway databases

PathwayCommonsiQ5SR56

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84641, 3 hits in 987 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MFSD14B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84641
PharosiQ5SR56, Tdark

Protein Ontology

More...
PROi
PR:Q5SR56
RNActiQ5SR56, protein

Gene expression databases

BgeeiENSG00000148110, Expressed in oviduct epithelium and 212 other tissues
ExpressionAtlasiQ5SR56, baseline and differential
GenevisibleiQ5SR56, HS

Family and domain databases

InterProiView protein in InterPro
IPR011701, MFS
IPR020846, MFS_dom
IPR036259, MFS_trans_sf
IPR005829, Sugar_transporter_CS
IPR001958, Tet-R_TetA/multi-R_MdtG
PfamiView protein in Pfam
PF07690, MFS_1, 1 hit
PRINTSiPR01035, TCRTETA
SUPFAMiSSF103473, SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMF14B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SR56
Secondary accession number(s): B4DUE6
, E9PD58, Q3KQT4, Q53GU5, Q8WU95, Q96SM4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 26, 2009
Last modified: April 7, 2021
This is version 136 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again