Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (16 Oct 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Hippocampus abundant transcript-like protein 1

Gene

MFSD14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.2.30 the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hippocampus abundant transcript-like protein 1Imported
Alternative name(s):
Major facilitator superfamily domain-containing 14BImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MFSD14BImported
Synonyms:HIATL1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23376 MFSD14B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SR56

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 49ExtracellularSequence analysisAdd BLAST49
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei50 – 70HelicalSequence analysisAdd BLAST21
Topological domaini71 – 82CytoplasmicSequence analysisAdd BLAST12
Transmembranei83 – 103HelicalSequence analysisAdd BLAST21
Topological domaini104 – 111ExtracellularSequence analysis8
Transmembranei112 – 132HelicalSequence analysisAdd BLAST21
Topological domaini133 – 134CytoplasmicSequence analysis2
Transmembranei135 – 155HelicalSequence analysisAdd BLAST21
Topological domaini156 – 168ExtracellularSequence analysisAdd BLAST13
Transmembranei169 – 189HelicalSequence analysisAdd BLAST21
Topological domaini190 – 196CytoplasmicSequence analysis7
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 255ExtracellularSequence analysisAdd BLAST38
Transmembranei256 – 276HelicalSequence analysisAdd BLAST21
Topological domaini277 – 281CytoplasmicSequence analysis5
Transmembranei282 – 302HelicalSequence analysisAdd BLAST21
Topological domaini303 – 319ExtracellularSequence analysisAdd BLAST17
Transmembranei320 – 340HelicalSequence analysisAdd BLAST21
Topological domaini341CytoplasmicSequence analysis1
Transmembranei342 – 362HelicalSequence analysisAdd BLAST21
Topological domaini363 – 387ExtracellularSequence analysisAdd BLAST25
Transmembranei388 – 408HelicalSequence analysisAdd BLAST21
Topological domaini409 – 428CytoplasmicSequence analysisAdd BLAST20
Transmembranei429 – 449HelicalSequence analysisAdd BLAST21
Topological domaini450 – 506ExtracellularSequence analysisAdd BLAST57

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000148110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671691

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5SR56

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MFSD14B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054382

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002392291 – 506Hippocampus abundant transcript-like protein 1Add BLAST506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi463N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5SR56

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SR56

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5SR56

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5SR56

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SR56

PeptideAtlas

More...
PeptideAtlasi
Q5SR56

PRoteomics IDEntifications database

More...
PRIDEi
Q5SR56

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5181
63839 [Q5SR56-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SR56

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SR56

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148110 Expressed in 201 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SR56 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SR56 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA017978

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124166, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SR56, 65 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364493

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the major facilitator superfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2816 Eukaryota
ENOG410ZVCA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156081

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007094

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SR56

Identification of Orthologs from Complete Genome Data

More...
OMAi
YLSAWYG

Database of Orthologous Groups

More...
OrthoDBi
763423at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SR56

TreeFam database of animal gene trees

More...
TreeFami
TF313511

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR005829 Sugar_transporter_CS
IPR001958 Tet-R_TetA/multi-R_MdtG

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07690 MFS_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01035 TCRTETA

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473 SSF103473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850 MFS, 1 hit
PS00216 SUGAR_TRANSPORT_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SR56-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVEPPPELE EKAASEPEAG AMPEKRAGAQ AAGSTWLQGF GRPSVYHAAI
60 70 80 90 100
VIFLEFFAWG LLTTPMLTVL HETFSQHTFL MNGLIQGVKG LLSFLSAPLI
110 120 130 140 150
GALSDVWGRK PFLLGTVFFT CFPIPLMRIS PWWYFAMISV SGVFSVTFSV
160 170 180 190 200
IFAYVADVTQ EHERSTAYGW VSATFAASLV SSPAIGAYLS ASYGDSLVVL
210 220 230 240 250
VATVVALLDI CFILVAVPES LPEKMRPVSW GAQISWKQAD PFASLKKVGK
260 270 280 290 300
DSTVLLICIT VFLSYLPEAG QYSSFFLYLR QVIGFGSVKI AAFIAMVGIL
310 320 330 340 350
SIVAQTAFLS ILMRSLGNKN TVLLGLGFQM LQLAWYGFGS QAWMMWAAGT
360 370 380 390 400
VAAMSSITFP AISALVSRNA ESDQQGVAQG IITGIRGLCN GLGPALYGFI
410 420 430 440 450
FYMFHVELTE LGPKLNSNNV PLQGAVIPGP PFLFGACIVL MSFLVALFIP
460 470 480 490 500
EYSKASGVQK HSNSSSGSLT NTPERGSDED IEPLLQDSSI WELSSFEEPG

NQCTEL
Length:506
Mass (Da):54,545
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CD09B8A06EC6EA5
GO
Isoform 2 (identifier: Q5SR56-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     344-376: MMWAAGTVAAMSSITFPAISALVSRNAESDQQG → SCPGDHNWNKRTMQWPGASTVWLHILHVPCGTD
     377-506: Missing.

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):34,048
Checksum:i8E5B8B10308D4ACF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSX1A0A0A0MSX1_HUMAN
Hippocampus abundant transcript-lik...
MFSD14B
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI06063 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55274 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD96556 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti367S → T in BAB55274 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055401406V → L1 PublicationCorresponds to variant dbSNP:rs17851857Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566921 – 65Missing in isoform 2. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_056693344 – 376MMWAA…SDQQG → SCPGDHNWNKRTMQWPGAST VWLHILHVPCGTD in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_056694377 – 506Missing in isoform 2. 1 PublicationAdd BLAST130

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027659 mRNA Translation: BAB55274.1 Different initiation.
AK300615 mRNA Translation: BAG62308.1
AL358232 Genomic DNA No translation available.
AL691447 Genomic DNA No translation available.
BC106062 mRNA Translation: AAI06063.1 Different initiation.
BC021093 mRNA Translation: AAH21093.2
AK222836 mRNA Translation: BAD96556.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6710.2 [Q5SR56-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115947.2, NM_032558.2 [Q5SR56-1]
XP_016870710.1, XM_017015221.1 [Q5SR56-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375344; ENSP00000364493; ENSG00000148110 [Q5SR56-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84641

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84641

UCSC genome browser

More...
UCSCi
uc004aur.4 human [Q5SR56-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027659 mRNA Translation: BAB55274.1 Different initiation.
AK300615 mRNA Translation: BAG62308.1
AL358232 Genomic DNA No translation available.
AL691447 Genomic DNA No translation available.
BC106062 mRNA Translation: AAI06063.1 Different initiation.
BC021093 mRNA Translation: AAH21093.2
AK222836 mRNA Translation: BAD96556.1 Different initiation.
CCDSiCCDS6710.2 [Q5SR56-1]
RefSeqiNP_115947.2, NM_032558.2 [Q5SR56-1]
XP_016870710.1, XM_017015221.1 [Q5SR56-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124166, 3 interactors
IntActiQ5SR56, 65 interactors
STRINGi9606.ENSP00000364493

Protein family/group databases

TCDBi2.A.1.2.30 the major facilitator superfamily (mfs)

PTM databases

iPTMnetiQ5SR56
PhosphoSitePlusiQ5SR56

Polymorphism and mutation databases

BioMutaiMFSD14B
DMDMi238054382

Proteomic databases

EPDiQ5SR56
jPOSTiQ5SR56
MassIVEiQ5SR56
MaxQBiQ5SR56
PaxDbiQ5SR56
PeptideAtlasiQ5SR56
PRIDEiQ5SR56
ProteomicsDBi5181
63839 [Q5SR56-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84641

Genome annotation databases

EnsembliENST00000375344; ENSP00000364493; ENSG00000148110 [Q5SR56-1]
GeneIDi84641
KEGGihsa:84641
UCSCiuc004aur.4 human [Q5SR56-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84641

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MFSD14B
HGNCiHGNC:23376 MFSD14B
HPAiHPA017978
neXtProtiNX_Q5SR56
OpenTargetsiENSG00000148110
PharmGKBiPA142671691

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2816 Eukaryota
ENOG410ZVCA LUCA
GeneTreeiENSGT00940000156081
HOGENOMiHOG000007094
InParanoidiQ5SR56
OMAiYLSAWYG
OrthoDBi763423at2759
PhylomeDBiQ5SR56
TreeFamiTF313511

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MFSD14B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84641
PharosiQ5SR56

Protein Ontology

More...
PROi
PR:Q5SR56

Gene expression databases

BgeeiENSG00000148110 Expressed in 201 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ5SR56 baseline and differential
GenevisibleiQ5SR56 HS

Family and domain databases

InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR005829 Sugar_transporter_CS
IPR001958 Tet-R_TetA/multi-R_MdtG
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
PRINTSiPR01035 TCRTETA
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit
PS00216 SUGAR_TRANSPORT_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMF14B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SR56
Secondary accession number(s): B4DUE6
, E9PD58, Q3KQT4, Q53GU5, Q8WU95, Q96SM4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 26, 2009
Last modified: October 16, 2019
This is version 127 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again