Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (18 Sep 2019)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

SH2 domain-containing protein 4B

Gene

SH2D4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q5SQS7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH2 domain-containing protein 4B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH2D4B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:31440 SH2D4B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SQS7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
387694

Open Targets

More...
OpenTargetsi
ENSG00000178217

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134943660

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH2D4B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74743565

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003086001 – 431SH2 domain-containing protein 4BAdd BLAST431

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SQS7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5SQS7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SQS7

PeptideAtlas

More...
PeptideAtlasi
Q5SQS7

PRoteomics IDEntifications database

More...
PRIDEi
Q5SQS7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
63819 [Q5SQS7-1]
63820 [Q5SQS7-2]
63821 [Q5SQS7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SQS7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SQS7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000178217 Expressed in 22 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SQS7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SQS7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040022

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q5SQS7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000345295

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5SQS7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini325 – 417SH2PROSITE-ProRule annotationAdd BLAST93

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi92 – 223Glu-richAdd BLAST132

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

SH2 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEFY Eukaryota
ENOG410XPPJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159732

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000031527

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SQS7

Identification of Orthologs from Complete Genome Data

More...
OMAi
QILHDMY

Database of Orthologous Groups

More...
OrthoDBi
782492at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SQS7

TreeFam database of animal gene trees

More...
TreeFami
TF336893

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10351 SH2_SH2D4B, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035839 SH2D4B_SH2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00017 SH2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401 SH2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50001 SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SQS7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQQILHDMY IDPELLAELS DVQKHILFYK MREEQLRRWK ERETWEALAQ
60 70 80 90 100
DEGLRPPKTK RASDKHIQWL LGADGEVWVW IMGEGPGDKP YEEISEELIA
110 120 130 140 150
ERARLQAQRE AEELWRQKEA EITKKFRDAL ANEKARILAE KWKVEMEDRK
160 170 180 190 200
AAKVLEERIH EEFKRKEEEE RKRGEEQIRL QEEQRAKELY WTLKQAQLHC
210 220 230 240 250
QASEKEEREW EEQLRRSKAA DEERSRRAQR ARDEYRHHSL RAIQKGTVAG
260 270 280 290 300
LSSMFRELGQ SHEQEARLYH HLPDPGLPQP LALPVRTWER PLRPVSRDVI
310 320 330 340 350
VRWFKEEQLP RRAGFERNTK FIAPWFHGII SREDAEALLE NMTEGAFLVR
360 370 380 390 400
VSEKIWGYTL SYRLQKGFKH FLVDASGDFY SFLGVDPNRH ATLTDLVDFH
410 420 430
KEEIITVSGG ELLQEPCGQR DSPPDYHLLF E
Note: No experimental confirmation available. Gene prediction based on similarity to orthologs and cDNA data.Curated
Length:431
Mass (Da):51,232
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5AB83BC426B0F8E9
GO
Isoform 2 (identifier: Q5SQS7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-61: R → RA
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

Note: No experimental confirmation available.Curated
Show »
Length:357
Mass (Da):42,756
Checksum:iFC26E899C3C35E9D
GO
Isoform 3 (identifier: Q5SQS7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKR → MLPEDSGGSPDAA
     285-285: V → VS
     329-431: IISREDAEAL...SPPDYHLLFE → GNYHCFRRRVTSGTLRTEGQPTRLPSVV

Note: No experimental confirmation available.Curated
Show »
Length:309
Mass (Da):36,467
Checksum:i2ADACD02D1D4DBDD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y5Q0A0A2R8Y5Q0_HUMAN
SH2 domain-containing protein 4B
SH2D4B
433Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti148D → G in BAC85715 (PubMed:14702039).Curated1
Sequence conflicti177Q → R in BAC85715 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056987237H → R. Corresponds to variant dbSNP:rs7075840Ensembl.1
Natural variantiVAR_056988239S → L. Corresponds to variant dbSNP:rs11817391Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0290091 – 61MLQQI…PKTKR → MLPEDSGGSPDAA in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_02901061R → RA in isoform 2. 1 Publication1
Alternative sequenceiVSP_029011285V → VS in isoform 3. 1 Publication1
Alternative sequenceiVSP_029012329 – 431IISRE…HLLFE → GNYHCFRRRVTSGTLRTEGQ PTRLPSVV in isoform 2 and isoform 3. 1 PublicationAdd BLAST103

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK123885 mRNA Translation: BAC85715.1
AK123978 mRNA Translation: BAC85741.1
AC021028 Genomic DNA No translation available.
AL731544 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44449.1 [Q5SQS7-3]
CCDS7370.1 [Q5SQS7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001139191.1, NM_001145719.1 [Q5SQS7-3]
NP_997255.2, NM_207372.2 [Q5SQS7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313455; ENSP00000314242; ENSG00000178217 [Q5SQS7-3]
ENST00000339284; ENSP00000345295; ENSG00000178217 [Q5SQS7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
387694

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:387694

UCSC genome browser

More...
UCSCi
uc001kck.1 human [Q5SQS7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK123885 mRNA Translation: BAC85715.1
AK123978 mRNA Translation: BAC85741.1
AC021028 Genomic DNA No translation available.
AL731544 Genomic DNA No translation available.
CCDSiCCDS44449.1 [Q5SQS7-3]
CCDS7370.1 [Q5SQS7-2]
RefSeqiNP_001139191.1, NM_001145719.1 [Q5SQS7-3]
NP_997255.2, NM_207372.2 [Q5SQS7-2]

3D structure databases

SMRiQ5SQS7
ModBaseiSearch...

Protein-protein interaction databases

ELMiQ5SQS7
STRINGi9606.ENSP00000345295

PTM databases

iPTMnetiQ5SQS7
PhosphoSitePlusiQ5SQS7

Polymorphism and mutation databases

BioMutaiSH2D4B
DMDMi74743565

Proteomic databases

jPOSTiQ5SQS7
MassIVEiQ5SQS7
PaxDbiQ5SQS7
PeptideAtlasiQ5SQS7
PRIDEiQ5SQS7
ProteomicsDBi63819 [Q5SQS7-1]
63820 [Q5SQS7-2]
63821 [Q5SQS7-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313455; ENSP00000314242; ENSG00000178217 [Q5SQS7-3]
ENST00000339284; ENSP00000345295; ENSG00000178217 [Q5SQS7-2]
GeneIDi387694
KEGGihsa:387694
UCSCiuc001kck.1 human [Q5SQS7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
387694
DisGeNETi387694

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH2D4B
HGNCiHGNC:31440 SH2D4B
HPAiHPA040022
neXtProtiNX_Q5SQS7
OpenTargetsiENSG00000178217
PharmGKBiPA134943660

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEFY Eukaryota
ENOG410XPPJ LUCA
GeneTreeiENSGT00940000159732
HOGENOMiHOG000031527
InParanoidiQ5SQS7
OMAiQILHDMY
OrthoDBi782492at2759
PhylomeDBiQ5SQS7
TreeFamiTF336893

Enzyme and pathway databases

SignaLinkiQ5SQS7

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
387694

Pharos

More...
Pharosi
Q5SQS7

Protein Ontology

More...
PROi
PR:Q5SQS7

Gene expression databases

BgeeiENSG00000178217 Expressed in 22 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ5SQS7 baseline and differential
GenevisibleiQ5SQS7 HS

Family and domain databases

CDDicd10351 SH2_SH2D4B, 1 hit
Gene3Di3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035839 SH2D4B_SH2
PfamiView protein in Pfam
PF00017 SH2, 1 hit
PRINTSiPR00401 SH2DOMAIN
SMARTiView protein in SMART
SM00252 SH2, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001 SH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH24B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SQS7
Secondary accession number(s): Q5SQS5, Q6ZVW9, Q6ZVZ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 21, 2004
Last modified: September 18, 2019
This is version 113 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again