Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (13 Feb 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Synaptosomal-associated protein 47

Gene

SNAP47

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in intracellular membrane fusion.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • SNAP receptor activity Source: GO_Central
  • syntaxin binding Source: GO_Central

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptosomal-associated protein 47
Short name:
SNAP-47
Alternative name(s):
Epididymis luminal protein 170
Synaptosomal-associated 47 kDa protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNAP47
Synonyms:C1orf142, HEL170, SVAP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143740.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30669 SNAP47

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5SQN1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
116841

Open Targets

More...
OpenTargetsi
ENSG00000143740

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164725983

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SNAP47

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054367

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003071511 – 464Synaptosomal-associated protein 47Add BLAST464

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5SQN1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5SQN1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5SQN1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5SQN1

PeptideAtlas

More...
PeptideAtlasi
Q5SQN1

PRoteomics IDEntifications database

More...
PRIDEi
Q5SQN1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
63811
63812 [Q5SQN1-2]
63813 [Q5SQN1-3]
63814 [Q5SQN1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5SQN1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5SQN1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143740 Expressed in 200 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5SQN1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5SQN1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028167

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a complex containing SNAP47, VAMP2 and STX1A (By similarity). Associates with the BLOC-1 complex. Interacts with BLOC1S6.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125534, 29 interactors

Protein interaction database and analysis system

More...
IntActi
Q5SQN1, 35 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355721

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5SQN1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini154 – 216t-SNARE coiled-coil homology 1PROSITE-ProRule annotationAdd BLAST63
Domaini401 – 463t-SNARE coiled-coil homology 2PROSITE-ProRule annotationAdd BLAST63

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SVAP1 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3065 Eukaryota
ENOG410Y3Y0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153618

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057915

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5SQN1

KEGG Orthology (KO)

More...
KOi
K18212

Identification of Orthologs from Complete Genome Data

More...
OMAi
QGEQFDN

Database of Orthologous Groups

More...
OrthoDBi
662135at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5SQN1

TreeFam database of animal gene trees

More...
TreeFami
TF331066

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR000727 T_SNARE_dom

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50192 T_SNARE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5SQN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRAARRGLHC AGAERPRRRG RLWDSSGVPQ RQKRPGPWRT QTQEQMSRDV
60 70 80 90 100
CIHTWPCTYY LEPKRRWVTG QLSLTSLSLR FMTDSTGEIL VSFPLSSIVE
110 120 130 140 150
IKKEASHFIF SSITILEKGH AKHWFSSLRP SRNVVFSIIE HFWRELLLSQ
160 170 180 190 200
PGAVADASVP RTRGEELTGL MAGSQKRLED TARVLHHQGQ QLDSVMRGLD
210 220 230 240 250
KMESDLEVAD RLLTELESPA WWPFSSKLWK TPPETKPRED VSMTSCEPFG
260 270 280 290 300
KEGILIKIPA VISHRTESHV KPGRLTVLVS GLEIHDSSSL LMHRFEREDV
310 320 330 340 350
DDIKVHSPYE ISIRQRFIGK PDMAYRLISA KMPEVIPILE VQFSKKMELL
360 370 380 390 400
EDALVLRSAR TSSPAEKSCS VWHAASGLMG RTLHREPPAG DQEGTALHLQ
410 420 430 440 450
TSLPALSEAD TQELTQILRR MKGLALEAES ELERQDEALD GVAAAVDRAT
460
LTIDKHNRRM KRLT
Length:464
Mass (Da):52,562
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFC4061061B0042ED
GO
Isoform 2 (identifier: Q5SQN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     417-464: ILRRMKGLAL...KHNRRMKRLT → GFRPMSLSTQTVLVMLCSESAGALWRQRLS

Show »
Length:446
Mass (Da):50,426
Checksum:i1E3234C0CA9733F8
GO
Isoform 3 (identifier: Q5SQN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-242: Missing.
     417-464: ILRRMKGLAL...KHNRRMKRLT → GFRPMSLSTQTVLVMLCSESAGALWRQRLS

Show »
Length:204
Mass (Da):22,643
Checksum:i4B47342BDE0CCACB
GO
Isoform 4 (identifier: Q5SQN1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-242: Missing.

Show »
Length:222
Mass (Da):24,779
Checksum:i67C964BEFAD2D416
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X0B7A0A087X0B7_HUMAN
Synaptosomal-associated protein 47
SNAP47
419Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3C7H7C3C7_HUMAN
Synaptosomal-associated protein 47
SNAP47
438Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KPT7U3KPT7_HUMAN
Synaptosomal-associated protein 47
SNAP47
222Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X2J6A0A087X2J6_HUMAN
Synaptosomal-associated protein 47
SNAP47
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y627H0Y627_HUMAN
Synaptosomal-associated protein 47
SNAP47
259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB70779 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84 – 86DST → TRP in AAH01332 (PubMed:15489334).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03536748R → G. Corresponds to variant dbSNP:rs2236359Ensembl.1
Natural variantiVAR_035368119G → R1 PublicationCorresponds to variant dbSNP:rs12239037Ensembl.1
Natural variantiVAR_035369154V → M2 PublicationsCorresponds to variant dbSNP:rs2236358Ensembl.1
Natural variantiVAR_035370381R → C2 PublicationsCorresponds to variant dbSNP:rs17851681Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0286131 – 242Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST242
Alternative sequenceiVSP_028614417 – 464ILRRM…MKRLT → GFRPMSLSTQTVLVMLCSES AGALWRQRLS in isoform 2 and isoform 3. 2 PublicationsAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY090635 mRNA Translation: AAM09082.1
BX648570 mRNA Translation: CAI45994.1
AL136378 Genomic DNA No translation available.
AL731702 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW69817.1
BC001332 mRNA Translation: AAH01332.1
BC004418 mRNA Translation: AAH04418.1
BC007786 mRNA Translation: AAH07786.2
BC011145 mRNA Translation: AAH11145.1
BC014059 mRNA Translation: AAH14059.2
BC018760 mRNA Translation: AAH18760.2
BC025231 mRNA Translation: AAH25231.1
BC032775 mRNA Translation: AAH32775.1
AK054633 mRNA Translation: BAB70779.1 Different initiation.
FJ236305 mRNA Translation: ACI45237.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1562.1 [Q5SQN1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001310864.1, NM_001323935.1 [Q5SQN1-2]
NP_444280.2, NM_053052.3 [Q5SQN1-1]
XP_016855720.1, XM_017000231.1 [Q5SQN1-1]
XP_016855721.1, XM_017000232.1 [Q5SQN1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.325081
Hs.745334

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000315781; ENSP00000314157; ENSG00000143740 [Q5SQN1-1]
ENST00000366759; ENSP00000355721; ENSG00000143740 [Q5SQN1-1]
ENST00000366760; ENSP00000355722; ENSG00000143740 [Q5SQN1-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116841

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:116841

UCSC genome browser

More...
UCSCi
uc001hra.3 human [Q5SQN1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY090635 mRNA Translation: AAM09082.1
BX648570 mRNA Translation: CAI45994.1
AL136378 Genomic DNA No translation available.
AL731702 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW69817.1
BC001332 mRNA Translation: AAH01332.1
BC004418 mRNA Translation: AAH04418.1
BC007786 mRNA Translation: AAH07786.2
BC011145 mRNA Translation: AAH11145.1
BC014059 mRNA Translation: AAH14059.2
BC018760 mRNA Translation: AAH18760.2
BC025231 mRNA Translation: AAH25231.1
BC032775 mRNA Translation: AAH32775.1
AK054633 mRNA Translation: BAB70779.1 Different initiation.
FJ236305 mRNA Translation: ACI45237.1
CCDSiCCDS1562.1 [Q5SQN1-1]
RefSeqiNP_001310864.1, NM_001323935.1 [Q5SQN1-2]
NP_444280.2, NM_053052.3 [Q5SQN1-1]
XP_016855720.1, XM_017000231.1 [Q5SQN1-1]
XP_016855721.1, XM_017000232.1 [Q5SQN1-1]
UniGeneiHs.325081
Hs.745334

3D structure databases

ProteinModelPortaliQ5SQN1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125534, 29 interactors
IntActiQ5SQN1, 35 interactors
STRINGi9606.ENSP00000355721

PTM databases

iPTMnetiQ5SQN1
PhosphoSitePlusiQ5SQN1

Polymorphism and mutation databases

BioMutaiSNAP47
DMDMi238054367

Proteomic databases

EPDiQ5SQN1
jPOSTiQ5SQN1
MaxQBiQ5SQN1
PaxDbiQ5SQN1
PeptideAtlasiQ5SQN1
PRIDEiQ5SQN1
ProteomicsDBi63811
63812 [Q5SQN1-2]
63813 [Q5SQN1-3]
63814 [Q5SQN1-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315781; ENSP00000314157; ENSG00000143740 [Q5SQN1-1]
ENST00000366759; ENSP00000355721; ENSG00000143740 [Q5SQN1-1]
ENST00000366760; ENSP00000355722; ENSG00000143740 [Q5SQN1-4]
GeneIDi116841
KEGGihsa:116841
UCSCiuc001hra.3 human [Q5SQN1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
116841
DisGeNETi116841
EuPathDBiHostDB:ENSG00000143740.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SNAP47

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0023151
HGNCiHGNC:30669 SNAP47
HPAiHPA028167
neXtProtiNX_Q5SQN1
OpenTargetsiENSG00000143740
PharmGKBiPA164725983

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3065 Eukaryota
ENOG410Y3Y0 LUCA
GeneTreeiENSGT00940000153618
HOVERGENiHBG057915
InParanoidiQ5SQN1
KOiK18212
OMAiQGEQFDN
OrthoDBi662135at2759
PhylomeDBiQ5SQN1
TreeFamiTF331066

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SNAP47 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
116841

Protein Ontology

More...
PROi
PR:Q5SQN1

Gene expression databases

BgeeiENSG00000143740 Expressed in 200 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiQ5SQN1 baseline and differential
GenevisibleiQ5SQN1 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR000727 T_SNARE_dom
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNP47_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SQN1
Secondary accession number(s): B6EDE0
, Q5HYB5, Q5TBZ3, Q8N558, Q8TB31, Q8TCW8, Q8WV46, Q96CQ3, Q96FE1, Q96I66, Q96NU3, Q9BT10, Q9BVB2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 26, 2009
Last modified: February 13, 2019
This is version 119 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again