Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5SQ64 (LY66F_HUMAN)

Entry version 134 (22 Apr 2020)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lymphocyte antigen 6 complex locus protein G6f

Gene

LY6G6F

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the downstream signal transduction pathways involving GRB2 and GRB7.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-114608 Platelet degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lymphocyte antigen 6 complex locus protein G6f
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LY6G6F
Synonyms:C6orf21, G6F, LY6G6D, NG32
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:13933 LY6G6F

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611404 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5SQ64

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini17 – 235ExtracellularSequence analysisAdd BLAST219
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei236 – 256HelicalSequence analysisAdd BLAST21
Topological domaini257 – 297CytoplasmicSequence analysisAdd BLAST41

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi281Y → F: No phosphorylation. No interaction with GRB2 and GRB7. No phosphorylation increase of p42/44 MAP kinase. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		259215

Open Targets

More...OpenTargetsi		ENSG00000204424
ENSG00000250641

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38371

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5SQ64 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LY6G6F

Domain mapping of disease mutations (DMDM)

More...DMDMi		172045922

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031892317 – 297Lymphocyte antigen 6 complex locus protein G6fAdd BLAST281

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 106PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi88N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei281Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5SQ64

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5SQ64

PeptideAtlas

More...PeptideAtlasi		Q5SQ64

PRoteomics IDEntifications database

More...PRIDEi		Q5SQ64

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		63788 [Q5SQ64-1]
83413

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5SQ64

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5SQ64

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000204424 Expressed in blood and 25 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5SQ64 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5SQ64 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000204424 Tissue enhanced (blood, bone marrow, lung, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked.

Interacts with GRB2 and GRB7 in a phosphorylation-dependent manner.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		129225, 5 interactors

Protein interaction database and analysis system

More...IntActi		Q5SQ64, 2 interactors

Molecular INTeraction database

More...MINTi		Q5SQ64

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000364992

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5SQ64 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 122Ig-like V-typeAdd BLAST106

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IJZB Eukaryota
ENOG41116W2 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000015960

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_071209_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5SQ64

KEGG Orthology (KO)

More...KOi		K20006

Identification of Orthologs from Complete Genome Data

More...OMAi		PRTICCL

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5SQ64

TreeFam database of animal gene trees

More...TreeFami		TF337100

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR026524 LY6G6d/LY6G6f

The PANTHER Classification System

More...PANTHERi		PTHR32286 PTHR32286, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07686 V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409 IG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5SQ64-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVLFLLLFL CGTPQAADNM QAIYVALGEA VELPCPSPPT LHGDEHLSWF 
        60         70         80         90        100
CSPAAGSFTT LVAQVQVGRP APDPGKPGRE SRLRLLGNYS LWLEGSKEED 
       110        120        130        140        150
AGRYWCAVLG QHHNYQNWRV YDVLVLKGSQ LSARAADGSP CNVLLCSVVP 
       160        170        180        190        200
SRRMDSVTWQ EGKGPVRGRV QSFWGSEAAL LLVCPGEGLS EPRSRRPRII 
       210        220        230        240        250
RCLMTHNKGV SFSLAASIDA SPALCAPSTG WDMPWILMLL LTMGQGVVIL 
       260        270        280        290 
ALSIVLWRQR VRGAPGRDAS IPQFKPEIQV YENIHLARLG PPAHKPR
Length:297
Mass (Da):32,465
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB4FFB401D70AA308
GO
Isoform 2 (identifier: Q5SQ64-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-297: DASIPQFKPEIQVYENIHLARLGPPAHKPR → GNRMRCYNCG...TCLLPGLWSG

Show »
Length:382
Mass (Da):40,892
Checksum:i6BE11E91E760C8CF
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD18078 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB63382 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03890834P → Q. Corresponds to variant dbSNP:rs17200983Ensembl.1
Natural variantiVAR_03890939P → S1 PublicationCorresponds to variant dbSNP:rs805295Ensembl.1
Natural variantiVAR_038910107A → T1 PublicationCorresponds to variant dbSNP:rs9267547Ensembl.1
Natural variantiVAR_038911167R → K. Corresponds to variant dbSNP:rs2242653Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055597268 – 297DASIP…AHKPR → GNRMRCYNCGGSPSSSCKEA VTTCGEGRPQPGLEQIKLPG NPPVTLIHQHPACVAAHHCN QVETESVGDVTYPAHRDCYL GDLCNSAVASHVAPAGILAA AATALTCLLPGLWSG in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ496460 mRNA Translation: CAD42968.1
AF129756 Genomic DNA Translation: AAD18078.1 Sequence problems.
BA000025 Genomic DNA Translation: BAB63382.1 Sequence problems.
AF195764 mRNA Translation: AAF35181.1
AL662899 Genomic DNA No translation available.
AL670886 Genomic DNA No translation available.
AL805934 Genomic DNA No translation available.
BX248244 Genomic DNA No translation available.
CR354443 Genomic DNA No translation available.
CR753842 Genomic DNA No translation available.
CR759787 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03485.1
CH471081 Genomic DNA Translation: EAX03487.1
BC137212 mRNA Translation: AAI37213.1
BC137213 mRNA Translation: AAI37214.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34403.1 [Q5SQ64-1]

NCBI Reference Sequences

More...RefSeqi		NP_001003693.1, NM_001003693.1 [Q5SQ64-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000375832; ENSP00000364992; ENSG00000204424 [Q5SQ64-1]
ENST00000383420; ENSP00000372912; ENSG00000243804
ENST00000442105; ENSP00000404621; ENSG00000241822
ENST00000446062; ENSP00000404884; ENSG00000239741 [Q5SQ64-1]
ENST00000447811; ENSP00000409959; ENSG00000240008 [Q5SQ64-1]
ENST00000453044; ENSP00000389102; ENSG00000240957 [Q5SQ64-1]
ENST00000455632; ENSP00000407535; ENSG00000243003 [Q5SQ64-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		259215

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:259215

UCSC genome browser

More...UCSCi		uc003nwa.2 human [Q5SQ64-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496460 mRNA Translation: CAD42968.1
AF129756 Genomic DNA Translation: AAD18078.1 Sequence problems.
BA000025 Genomic DNA Translation: BAB63382.1 Sequence problems.
AF195764 mRNA Translation: AAF35181.1
AL662899 Genomic DNA No translation available.
AL670886 Genomic DNA No translation available.
AL805934 Genomic DNA No translation available.
BX248244 Genomic DNA No translation available.
CR354443 Genomic DNA No translation available.
CR753842 Genomic DNA No translation available.
CR759787 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03485.1
CH471081 Genomic DNA Translation: EAX03487.1
BC137212 mRNA Translation: AAI37213.1
BC137213 mRNA Translation: AAI37214.1
CCDSiCCDS34403.1 [Q5SQ64-1]
RefSeqiNP_001003693.1, NM_001003693.1 [Q5SQ64-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi129225, 5 interactors
IntActiQ5SQ64, 2 interactors
MINTiQ5SQ64
STRINGi9606.ENSP00000364992

PTM databases

iPTMnetiQ5SQ64
PhosphoSitePlusiQ5SQ64

Polymorphism and mutation databases

BioMutaiLY6G6F
DMDMi172045922

Proteomic databases

MassIVEiQ5SQ64
PaxDbiQ5SQ64
PeptideAtlasiQ5SQ64
PRIDEiQ5SQ64
ProteomicsDBi63788 [Q5SQ64-1]
83413

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34899 135 antibodies

Genome annotation databases

EnsembliENST00000375832; ENSP00000364992; ENSG00000204424 [Q5SQ64-1]
ENST00000383420; ENSP00000372912; ENSG00000243804
ENST00000442105; ENSP00000404621; ENSG00000241822
ENST00000446062; ENSP00000404884; ENSG00000239741 [Q5SQ64-1]
ENST00000447811; ENSP00000409959; ENSG00000240008 [Q5SQ64-1]
ENST00000453044; ENSP00000389102; ENSG00000240957 [Q5SQ64-1]
ENST00000455632; ENSP00000407535; ENSG00000243003 [Q5SQ64-1]
GeneIDi259215
KEGGihsa:259215
UCSCiuc003nwa.2 human [Q5SQ64-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		259215
DisGeNETi259215

GeneCards: human genes, protein and diseases

More...GeneCardsi		LY6G6F
HGNCiHGNC:13933 LY6G6F
HPAiENSG00000204424 Tissue enhanced (blood, bone marrow, lung, lymphoid tissue)
MIMi611404 gene
neXtProtiNX_Q5SQ64
OpenTargetsiENSG00000204424
ENSG00000250641
PharmGKBiPA38371

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IJZB Eukaryota
ENOG41116W2 LUCA
GeneTreeiENSGT00390000015960
HOGENOMiCLU_071209_0_0_1
InParanoidiQ5SQ64
KOiK20006
OMAiPRTICCL
PhylomeDBiQ5SQ64
TreeFamiTF337100

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		259215
PharosiQ5SQ64 Tdark

Protein Ontology

More...PROi		PR:Q5SQ64
RNActiQ5SQ64 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000204424 Expressed in blood and 25 other tissues
ExpressionAtlasiQ5SQ64 baseline and differential
GenevisibleiQ5SQ64 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR026524 LY6G6d/LY6G6f
PANTHERiPTHR32286 PTHR32286, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLY66F_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5SQ64
Secondary accession number(s): B0UXB7
, O95869, Q7Z5H2, Q96QC7, Q9NZJ1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: April 22, 2020
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again