UniProtKB - Q5SHP8 (RL14_THET8)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q5SHP8|RL14_THET8 50S ribosomal protein L14 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) OX=300852 GN=rplN PE=1 SV=1 MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKA VVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPE VL
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
50S ribosomal protein L14
rplN
Annotation score:3 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- rRNA binding Source: UniProtKB-KW
- structural constituent of ribosome Source: InterPro
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- translation Source: InterPro
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | TTHE300852:G1GKC-1688-MONOMER |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: 50S ribosomal protein L14UniRule annotation<p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:rplNUniRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Ordered Locus Names:TTHA1682 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 300852 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Bacteria › Terrabacteria group › Deinococcus-Thermus › Deinococci › Thermales › Thermaceae › Thermus › Thermus thermophilus |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- large ribosomal subunit Source: InterPro
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000128566 | 1 – 122 | 50S ribosomal protein L14Add BLAST | 122 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Protein-protein interaction databases
STRING: functional protein association networks More...STRINGi | 300852.TTHA1682 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 7 – 10 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 12 – 24 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 13 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 26 – 29 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 38 – 46 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 48 – 51 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 57 – 64 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 76 – 81 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 83 – 87 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 93 – 96 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 105 – 108 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 112 – 117 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q5SHP8 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q5SHP8 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | Q5SHP8 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
<p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4108UNN Bacteria COG0093 LUCA |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000183702 |
KEGG Orthology (KO) More...KOi | K02874 |
Identification of Orthologs from Complete Genome Data More...OMAi | IKGPVAR |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q5SHP8 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.40.150.20, 1 hit |
HAMAP database of protein families More...HAMAPi | MF_01367 Ribosomal_L14, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR036853 Ribosomal_L14_sf IPR000218 Ribosomal_L14P IPR005745 Ribosomal_L14P_bac-type IPR019972 Ribosomal_L14P_CS |
The PANTHER Classification System More...PANTHERi | PTHR11761 PTHR11761, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00238 Ribosomal_L14, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM01374 Ribosomal_L14, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF50193 SSF50193, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR01067 rplN_bact, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00049 RIBOSOMAL_L14, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
10 20 30 40 50
MIQPQTYLEV ADNTGARKIM CIRVLKGSNA KYATVGDVIV ASVKEAIPRG
60 70 80 90 100
AVKEGDVVKA VVVRTKKEIK RPDGSAIRFD DNAAVIINNQ LEPRGTRVFG
110 120
PVARELREKG FMKIVSLAPE VL
<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.3"Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry."
Suh M.-J., Hamburg D.M., Gregory S.T., Dahlberg A.E., Limbach P.A.
Proteomics 5:4818-4831(2005) [PubMed] [Europe PMC] [Abstract]Cited for: MASS SPECTROMETRY.
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AP008226 Genomic DNA Translation: BAD71505.1 |
NCBI Reference Sequences More...RefSeqi | WP_011228844.1, NC_006461.1 YP_144948.1, NC_006461.1 |
Genome annotation databases
Ensembl bacterial and archaeal genome annotation project More...EnsemblBacteriai | BAD71505; BAD71505; BAD71505 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 3168727 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ttj:TTHA1682 |
Pathosystems Resource Integration Center (PATRIC) More...PATRICi | fig|300852.9.peg.1652 |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length |
|---|
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q5SHP8 | 50S ribosomal protein L14 | ) | 122 | ||
| 50S ribosomal protein L14 | 122 | ||||
| 50S ribosomal protein L14 | ) | 122 | |||
| 50S ribosomal protein L14 | 122 | ||||
| 50S ribosomal protein L14 | 122 | ||||
| +17 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q5SHP8 | 50S ribosomal protein L14 | ) | 122 | ||
| UPI000CF96988 | 122 | ||||
| 50S ribosomal protein L14 | 122 | ||||
| 50S ribosomal protein L14 | 122 | ||||
| 50S ribosomal protein L14 | ) | 122 | |||
| +15398 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AP008226 Genomic DNA Translation: BAD71505.1 |
NCBI Reference Sequences More...RefSeqi | WP_011228844.1, NC_006461.1 YP_144948.1, NC_006461.1 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1VVJ | X-ray | 3.44 | RO/YO | 1-122 | [»] | |
| 1VY4 | X-ray | 2.60 | BO/DO | 1-122 | [»] | |
| 1VY5 | X-ray | 2.55 | BO/DO | 1-122 | [»] | |
| 1VY6 | X-ray | 2.90 | BO/DO | 1-122 | [»] | |
| 1VY7 | X-ray | 2.80 | BO/DO | 1-122 | [»] | |
| 4L47 | X-ray | 3.22 | RO/YO | 1-122 | [»] | |
| 4L71 | X-ray | 3.90 | RO/YO | 1-122 | [»] | |
| 4LEL | X-ray | 3.90 | RO/YO | 1-122 | [»] | |
| 4LFZ | X-ray | 3.92 | RO/YO | 1-122 | [»] | |
| 4LNT | X-ray | 2.94 | RO/YO | 1-122 | [»] | |
| 4LSK | X-ray | 3.48 | RO/YO | 1-122 | [»] | |
| 4LT8 | X-ray | 3.14 | RO/YO | 1-122 | [»] | |
| 4P6F | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 4P70 | X-ray | 3.68 | RO/YO | 1-122 | [»] | |
| 4TUA | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 4TUB | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 4TUC | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 4TUD | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 4TUE | X-ray | 3.50 | RO/YO | 1-122 | [»] | |
| 4V42 | X-ray | 5.50 | BN | 57-121 | [»] | |
| 4V4P | X-ray | 5.50 | N | 52-121 | [»] | |
| 4V4X | X-ray | 5.00 | BN | 1-122 | [»] | |
| 4V4Y | X-ray | 5.50 | BN | 1-122 | [»] | |
| 4V4Z | X-ray | 4.51 | BN | 1-122 | [»] | |
| 4V51 | X-ray | 2.80 | BO/DO | 1-122 | [»] | |
| 4V5A | X-ray | 3.50 | BO/DO | 1-122 | [»] | |
| 4V5C | X-ray | 3.30 | BO/DO | 1-122 | [»] | |
| 4V5D | X-ray | 3.50 | BO/DO | 1-122 | [»] | |
| 4V5E | X-ray | 3.45 | BO/DO | 1-122 | [»] | |
| 4V5F | X-ray | 3.60 | BO/DO | 1-122 | [»] | |
| 4V5G | X-ray | 3.60 | BO/DO | 1-122 | [»] | |
| 4V5J | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V5K | X-ray | 3.20 | BO/DO | 1-122 | [»] | |
| 4V5L | X-ray | 3.10 | BO | 1-122 | [»] | |
| 4V5M | electron microscopy | 7.80 | BO | 1-122 | [»] | |
| 4V5N | electron microscopy | 7.60 | BO | 1-122 | [»] | |
| 4V5P | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V5Q | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V5R | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V5S | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V68 | electron microscopy | 6.40 | BO | 1-122 | [»] | |
| 4V6A | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V6F | X-ray | 3.10 | AN/DN | 1-122 | [»] | |
| 4V6G | X-ray | 3.50 | BN/DN | 1-122 | [»] | |
| 4V7J | X-ray | 3.30 | AO/BO | 1-122 | [»] | |
| 4V7K | X-ray | 3.60 | AO/BO | 1-122 | [»] | |
| 4V7L | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V7M | X-ray | 3.45 | BO/DO | 1-122 | [»] | |
| 4V7W | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V7X | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V7Y | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V7Z | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V87 | X-ray | 3.10 | AN/DN | 1-122 | [»] | |
| 4V8A | X-ray | 3.20 | AO/BO | 1-122 | [»] | |
| 4V8B | X-ray | 3.00 | BN/DN | 1-122 | [»] | |
| 4V8C | X-ray | 3.30 | AN/BN | 1-122 | [»] | |
| 4V8D | X-ray | 3.00 | BN/DN | 1-122 | [»] | |
| 4V8E | X-ray | 3.30 | AN/CN | 1-122 | [»] | |
| 4V8F | X-ray | 3.30 | AN/DN | 1-122 | [»] | |
| 4V8G | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V8H | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V8I | X-ray | 2.70 | BO/DO | 1-122 | [»] | |
| 4V8J | X-ray | 3.90 | BO/DO | 1-122 | [»] | |
| 4V8N | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4V8O | X-ray | 3.80 | BO | 1-122 | [»] | |
| 4V8Q | X-ray | 3.10 | AO | 1-122 | [»] | |
| 4V8U | X-ray | 3.70 | BO/DO | 1-122 | [»] | |
| 4V8X | X-ray | 3.35 | BO/DO | 1-122 | [»] | |
| 4V90 | X-ray | 2.95 | BO | 1-122 | [»] | |
| 4V95 | X-ray | 3.20 | BO/DO | 1-122 | [»] | |
| 4V97 | X-ray | 3.52 | BO/DO | 1-122 | [»] | |
| 4V9A | X-ray | 3.30 | BN/DN | 1-122 | [»] | |
| 4V9B | X-ray | 3.10 | BN/DN | 1-122 | [»] | |
| 4V9H | X-ray | 2.86 | BO | 1-122 | [»] | |
| 4V9I | X-ray | 3.30 | BO/DO | 1-122 | [»] | |
| 4V9R | X-ray | 3.00 | BO/DO | 1-122 | [»] | |
| 4V9S | X-ray | 3.10 | BO/DO | 1-122 | [»] | |
| 4W2E | X-ray | 2.90 | O | 1-122 | [»] | |
| 4W2F | X-ray | 2.40 | BO/DO | 1-122 | [»] | |
| 4W2G | X-ray | 2.55 | BO/DO | 1-122 | [»] | |
| 4W2H | X-ray | 2.70 | BO/DO | 1-122 | [»] | |
| 4W2I | X-ray | 2.70 | BO/DO | 1-122 | [»] | |
| 4W4G | X-ray | 3.30 | RO/YO | 1-122 | [»] | |
| 4WPO | X-ray | 2.80 | AO/CO | 1-122 | [»] | |
| 4WQ1 | X-ray | 3.10 | 25/68 | 1-122 | [»] | |
| 4WQF | X-ray | 2.80 | AO/CO | 1-122 | [»] | |
| 4WQR | X-ray | 3.15 | 25/68 | 1-122 | [»] | |
| 4WQU | X-ray | 2.80 | AO/CO | 1-122 | [»] | |
| 4WQY | X-ray | 2.80 | AO/CO | 1-122 | [»] | |
| 4WR6 | X-ray | 3.05 | 25/68 | 1-122 | [»] | |
| 4WRA | X-ray | 3.05 | 25/68 | 1-122 | [»] | |
| 4WRO | X-ray | 3.05 | 68 | 1-122 | [»] | |
| 4WSD | X-ray | 2.95 | 25/68 | 1-122 | [»] | |
| 4WSM | X-ray | 3.30 | 25/68 | 1-122 | [»] | |
| 4WT1 | X-ray | 3.05 | 25/68 | 1-122 | [»] | |
| 4WT8 | X-ray | 3.40 | CN/DN | 1-122 | [»] | |
| 4WU1 | X-ray | 3.20 | 25/68 | 1-122 | [»] | |
| 4WZD | X-ray | 3.10 | 25/68 | 1-122 | [»] | |
| 4WZO | X-ray | 3.30 | 25/68 | 1-122 | [»] | |
| 4Y4O | X-ray | 2.30 | 1O/2O | 1-122 | [»] | |
| 4Y4P | X-ray | 2.50 | 1O/2O | 1-122 | [»] | |
| 4YPB | X-ray | 3.40 | RO/YO | 1-122 | [»] | |
| 4YZV | X-ray | 3.10 | RO/YO | 1-122 | [»] | |
| 4Z3S | X-ray | 2.65 | 1O/2O | 1-122 | [»] | |
| 4Z8C | X-ray | 2.90 | 1O/2O | 1-122 | [»] | |
| 4ZER | X-ray | 3.10 | 1O/2O | 1-122 | [»] | |
| 4ZSN | X-ray | 3.60 | RO/YO | 1-122 | [»] | |
| 5A9Z | electron microscopy | 4.70 | AL | 1-122 | [»] | |
| 5AA0 | electron microscopy | 5.00 | AL | 1-122 | [»] | |
| 5CZP | X-ray | 3.30 | RO/YO | 1-122 | [»] | |
| 5D8B | X-ray | 3.63 | EB/I | 1-122 | [»] | |
| 5DFE | X-ray | 3.10 | RO/YO | 1-122 | [»] | |
| 5DOX | X-ray | 3.10 | 1O/2O | 1-122 | [»] | |
| 5DOY | X-ray | 2.60 | 1O/2O | 1-122 | [»] | |
| 5E7K | X-ray | 3.20 | 25/68 | 1-122 | [»] | |
| 5E81 | X-ray | 2.95 | 25/68 | 1-122 | [»] | |
| 5EL4 | X-ray | 3.15 | 25/68 | 1-122 | [»] | |
| 5EL5 | X-ray | 3.15 | 25/68 | 1-122 | [»] | |
| 5EL6 | X-ray | 3.10 | 25/68 | 1-122 | [»] | |
| 5EL7 | X-ray | 3.15 | 25/68 | 1-122 | [»] | |
| 5F8K | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5FDU | X-ray | 2.90 | 1O/2O | 1-122 | [»] | |
| 5FDV | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5HAU | X-ray | 3.00 | 1M/2M | 1-122 | [»] | |
| 5HCP | X-ray | 2.89 | 1O/2O | 1-122 | [»] | |
| 5HCQ | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5HCR | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5HD1 | X-ray | 2.70 | 1O/2O | 1-122 | [»] | |
| 5IB7 | X-ray | 2.99 | 25/68 | 1-122 | [»] | |
| 5IB8 | X-ray | 3.13 | 25/68 | 1-122 | [»] | |
| 5IBB | X-ray | 2.96 | 25/68 | 1-122 | [»] | |
| 5J30 | X-ray | 3.20 | RO/YO | 1-122 | [»] | |
| 5J3C | X-ray | 3.04 | RO/YO | 1-122 | [»] | |
| 5J4B | X-ray | 2.60 | 1O/2O | 1-122 | [»] | |
| 5J4C | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5J8B | X-ray | 2.60 | O | 1-122 | [»] | |
| 5NDJ | X-ray | 3.15 | 25/68 | 1-122 | [»] | |
| 5NDK | X-ray | 2.95 | 25/68 | 1-122 | [»] | |
| 5OT7 | electron microscopy | 3.80 | p | 1-122 | [»] | |
| 5UQ7 | electron microscopy | 3.50 | O | 1-122 | [»] | |
| 5UQ8 | electron microscopy | 3.20 | O | 1-122 | [»] | |
| 5VP2 | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 5W4K | X-ray | 2.70 | 1O/2O | 1-122 | [»] | |
| 5WIS | X-ray | 2.70 | 1O/2O | 1-122 | [»] | |
| 5WIT | X-ray | 2.60 | 1O/2O | 1-122 | [»] | |
| 6C5L | X-ray | 3.20 | BO/DO | 1-122 | [»] | |
| 6CAE | X-ray | 2.60 | 1O/2O | 1-122 | [»] | |
| 6CFJ | X-ray | 2.80 | 1O/2O | 1-122 | [»] | |
| 6CFK | X-ray | 2.70 | 1O/2O | 1-122 | [»] | |
| 6CFL | X-ray | 2.60 | 1O/2O | 1-122 | [»] | |
| 6FKR | X-ray | 3.20 | 1O/2O | 1-122 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q5SHP8 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q5SHP8 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
STRING: functional protein association networks More...STRINGi | 300852.TTHA1682 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl bacterial and archaeal genome annotation project More...EnsemblBacteriai | BAD71505; BAD71505; BAD71505 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 3168727 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ttj:TTHA1682 |
Pathosystems Resource Integration Center (PATRIC) More...PATRICi | fig|300852.9.peg.1652 |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4108UNN Bacteria COG0093 LUCA |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000183702 |
KEGG Orthology (KO) More...KOi | K02874 |
Identification of Orthologs from Complete Genome Data More...OMAi | IKGPVAR |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q5SHP8 |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | TTHE300852:G1GKC-1688-MONOMER |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | Q5SHP8 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.40.150.20, 1 hit |
HAMAP database of protein families More...HAMAPi | MF_01367 Ribosomal_L14, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR036853 Ribosomal_L14_sf IPR000218 Ribosomal_L14P IPR005745 Ribosomal_L14P_bac-type IPR019972 Ribosomal_L14P_CS |
The PANTHER Classification System More...PANTHERi | PTHR11761 PTHR11761, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00238 Ribosomal_L14, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM01374 Ribosomal_L14, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF50193 SSF50193, 1 hit |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR01067 rplN_bact, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00049 RIBOSOMAL_L14, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | RL14_THET8 | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q5SHP8Primary (citable) accession number: Q5SHP8 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | March 29, 2005 |
| Last sequence update: | December 21, 2004 | |
| Last modified: | June 20, 2018 | |
| This is version 123 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Prokaryotic Protein Annotation Program | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- PDB cross-references
Index of Protein Data Bank (PDB) cross-references - Ribosomal proteins
Ribosomal proteins families and list of entries - SIMILARITY comments
Index of protein domains and families
