Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5RL73 (RBM48_HUMAN)

Entry version 137 (07 Oct 2020)
Sequence version 1 (21 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

RNA-binding protein 48

Gene

RBM48

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5RL73

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RNA-binding protein 48
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBM48
Synonyms:C7orf64
ORF Names:HSPC304
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000127993.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:21785, RBM48

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5RL73

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84060

Open Targets

More...OpenTargetsi		ENSG00000127993

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164717383

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5RL73, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RBM48

Domain mapping of disease mutations (DMDM)

More...DMDMi		74736145

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003215141 – 367RNA-binding protein 48Add BLAST367

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5RL73

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5RL73

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5RL73

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5RL73

PeptideAtlas

More...PeptideAtlasi		Q5RL73

PRoteomics IDEntifications database

More...PRIDEi		Q5RL73

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		63754 [Q5RL73-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5RL73

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5RL73

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000127993, Expressed in medial globus pallidus and 218 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5RL73, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5RL73, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000127993, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini46 – 124RRMAdd BLAST79

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RBM48 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QSNB, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000004541

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_065720_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5RL73

Identification of Orthologs from Complete Genome Data

More...OMAi		KATNQRD

Database of Orthologous Groups

More...OrthoDBi		1117000at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5RL73

TreeFam database of animal gene trees

More...TreeFami		TF328457

Family and domain databases

Conserved Domains Database

More...CDDi		cd12442, RRM_RBM48, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035979, RBD_domain_sf
IPR039599, RBM48
IPR034264, RBM48_RRM

The PANTHER Classification System

More...PANTHERi		PTHR20957, PTHR20957, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928, SSF54928, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5RL73-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSGGELGS LFDHHVQRAV CDTRAKYREG RRPRAVKVYT INLESQYLLI 
        60         70         80         90        100
QGVPAVGVMK ELVERFALYG AIEQYNALDE YPAEDFTEVY LIKFMNLQSA 
       110        120        130        140        150
RTAKRKMDEQ SFFGGLLHVC YAPEFETVEE TRKKLQMRKA YVVKTTENKD 
       160        170        180        190        200
HYVTKKKLVT EHKDTEDFRQ DFHSEMSGFC KAALNTSAGN SNPYLPYSCE 
       210        220        230        240        250
LPLCYFSSKC MCSSGGPVDR APDSSKDGRN HHKTMGHYNH NDSLRKTQIN 
       260        270        280        290        300
SLKNSVACPG AQKAITSSEA VDRFMPRTTQ LQERKRRRED DRKLGTFLQT 
       310        320        330        340        350
NPTGNEIMIG PLLPDISKVD MHDDSLNTTA NLIRHKLKEV ISSVPKPPED 
       360 
KPEDVHTSHP LKQRRRI
Length:367
Mass (Da):41,808
Last modified:December 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBD42E7ACCDCE9B96
GO
Isoform 2 (identifier: Q5RL73-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-367: ISSVPKPPEDKPEDVHTSHPLKQRRRI → RLFLKNYSKTRFGYRIKWRIICGNNSTVIFFHFLVF

Show »
Length:376
Mass (Da):43,147
Checksum:iFE38159A4272BFCA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J787C9J787_HUMAN
RNA-binding protein 48
RBM48
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH33561 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAB70806 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAB66554 differs from that shown. Reason: Frameshift.Curated
The sequence CAI45942 differs from that shown. Reason: Erroneous translation. The protein sequence does not correspond to the translation of the nucleic acid sequence.Curated
The sequence EAL24148 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8L → P in CAB66554 (PubMed:11230166).Curated1
Sequence conflicti229R → K in BAB70806 (PubMed:14702039).Curated1
Sequence conflicti359H → R in BAB70806 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056683341 – 367ISSVP…QRRRI → RLFLKNYSKTRFGYRIKWRI ICGNNSTVIFFHFLVF in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL136619 mRNA Translation: CAB66554.1 Frameshift.
CR933641 mRNA Translation: CAI45942.1 Sequence problems.
AK054777 mRNA Translation: BAB70806.1 Different initiation.
AK294812 mRNA Translation: BAH11891.1
AC005156 Genomic DNA No translation available.
AC007566 Genomic DNA No translation available.
CH471091 Genomic DNA Translation: EAW76839.1
CH236949 Genomic DNA Translation: EAL24148.1 Sequence problems.
BC033561 mRNA Translation: AAH33561.1 Different initiation.
BC044570 mRNA Translation: AAH44570.1
BC104865 mRNA Translation: AAI04866.1
BC104867 mRNA Translation: AAI04868.1
BC143576 mRNA Translation: AAI43577.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43615.1 [Q5RL73-1]

NCBI Reference Sequences

More...RefSeqi		NP_115496.2, NM_032120.3 [Q5RL73-1]
XP_005250693.1, XM_005250636.4 [Q5RL73-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265732; ENSP00000265732; ENSG00000127993 [Q5RL73-1]
ENST00000481551; ENSP00000419242; ENSG00000127993 [Q5RL73-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84060

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84060

UCSC genome browser

More...UCSCi		uc003ulz.4, human [Q5RL73-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136619 mRNA Translation: CAB66554.1 Frameshift.
CR933641 mRNA Translation: CAI45942.1 Sequence problems.
AK054777 mRNA Translation: BAB70806.1 Different initiation.
AK294812 mRNA Translation: BAH11891.1
AC005156 Genomic DNA No translation available.
AC007566 Genomic DNA No translation available.
CH471091 Genomic DNA Translation: EAW76839.1
CH236949 Genomic DNA Translation: EAL24148.1 Sequence problems.
BC033561 mRNA Translation: AAH33561.1 Different initiation.
BC044570 mRNA Translation: AAH44570.1
BC104865 mRNA Translation: AAI04866.1
BC104867 mRNA Translation: AAI04868.1
BC143576 mRNA Translation: AAI43577.1
CCDSiCCDS43615.1 [Q5RL73-1]
RefSeqiNP_115496.2, NM_032120.3 [Q5RL73-1]
XP_005250693.1, XM_005250636.4 [Q5RL73-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi123855, 72 interactors
IntActiQ5RL73, 72 interactors
MINTiQ5RL73
STRINGi9606.ENSP00000265732

PTM databases

iPTMnetiQ5RL73
PhosphoSitePlusiQ5RL73

Polymorphism and mutation databases

BioMutaiRBM48
DMDMi74736145

Proteomic databases

EPDiQ5RL73
MassIVEiQ5RL73
MaxQBiQ5RL73
PaxDbiQ5RL73
PeptideAtlasiQ5RL73
PRIDEiQ5RL73
ProteomicsDBi63754 [Q5RL73-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		8703, 124 antibodies

Genome annotation databases

EnsembliENST00000265732; ENSP00000265732; ENSG00000127993 [Q5RL73-1]
ENST00000481551; ENSP00000419242; ENSG00000127993 [Q5RL73-2]
GeneIDi84060
KEGGihsa:84060
UCSCiuc003ulz.4, human [Q5RL73-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84060
DisGeNETi84060
EuPathDBiHostDB:ENSG00000127993.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		RBM48
HGNCiHGNC:21785, RBM48
HPAiENSG00000127993, Low tissue specificity
neXtProtiNX_Q5RL73
OpenTargetsiENSG00000127993
PharmGKBiPA164717383

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QSNB, Eukaryota
GeneTreeiENSGT00390000004541
HOGENOMiCLU_065720_0_0_1
InParanoidiQ5RL73
OMAiKATNQRD
OrthoDBi1117000at2759
PhylomeDBiQ5RL73
TreeFamiTF328457

Enzyme and pathway databases

PathwayCommonsiQ5RL73

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84060, 478 hits in 879 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RBM48, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84060
PharosiQ5RL73, Tdark

Protein Ontology

More...PROi		PR:Q5RL73
RNActiQ5RL73, protein

Gene expression databases

BgeeiENSG00000127993, Expressed in medial globus pallidus and 218 other tissues
ExpressionAtlasiQ5RL73, baseline and differential
GenevisibleiQ5RL73, HS

Family and domain databases

CDDicd12442, RRM_RBM48, 1 hit
InterProiView protein in InterPro
IPR035979, RBD_domain_sf
IPR039599, RBM48
IPR034264, RBM48_RRM
PANTHERiPTHR20957, PTHR20957, 1 hit
SUPFAMiSSF54928, SSF54928, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBM48_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5RL73
Secondary accession number(s): B7Z2K5
, B7ZL51, Q5H9T2, Q8IYW7, Q96NS0, Q9H0V7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: December 21, 2004
Last modified: October 7, 2020
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again