Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (12 Aug 2020)
Sequence version 1 (05 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rab GTPase-activating protein 1-like

Gene

RABGAP1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTP-hydrolysis activating protein (GAP) for small GTPase RAB22A, converting active RAB22A-GTP to the inactive form RAB22A-GDP (PubMed:16923123). Plays a role in endocytosis and intracellular protein transport. Recruited by ANK2 to phosphatidylinositol 3-phosphate (PI3P)-positive early endosomes, where it inactivates RAB22A, and promotes polarized trafficking to the leading edge of the migrating cells. Part of the ANK2/RABGAP1L complex which is required for the polarized recycling of fibronectin receptor ITGA5 ITGB1 to the plasma membrane that enables continuous directional cell migration (By similarity).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei580Arginine fingerBy similarity1
Sitei621Glutamine fingerBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
Biological processEndocytosis, Protein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5R372

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab GTPase-activating protein 1-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RABGAP1LImported
Synonyms:HHLImported, KIAA0471Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000152061.22

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24663, RABGAP1L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609238, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5R372

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle, Endosome, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Leukemia, acute myelogenous (AML)1 Publication
The gene represented in this entry may be involved in disease pathogenesis.
Disease descriptionA subtype of acute leukemia, a cancer of the white blood cells. AML is a malignant disease of bone marrow characterized by maturational arrest of hematopoietic precursors at an early stage of development. Clonal expansion of myeloid blasts occurs in bone marrow, blood, and other tissue. Myelogenous leukemias develop from changes in cells that normally produce neutrophils, basophils, eosinophils and monocytes.
Related information in OMIM
A chromosomal aberration involving RABGAP1L has been found in bone marrow cells from a child with leukemia, acute myelogenous. Translocation der(Y)t(Y;1)(q12;q25). The breakpoint at 1q25 disrupts RABGAP1L.1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
9910
MIMi601626, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000152061

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134940645

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5R372, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RABGAP1L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205829393

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003480541 – 815Rab GTPase-activating protein 1-likeAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei471PhosphothreonineCombined sources1
Modified residuei480PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5R372

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5R372

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5R372

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5R372

PeptideAtlas

More...
PeptideAtlasi
Q5R372

PRoteomics IDEntifications database

More...
PRIDEi
Q5R372

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
63709 [Q5R372-1]
63710 [Q5R372-2]
63711 [Q5R372-3]
63712 [Q5R372-4]
63713 [Q5R372-5]
63714 [Q5R372-6]
63715 [Q5R372-7]
63716 [Q5R372-8]
63717 [Q5R372-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5R372

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q5R372

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5R372

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in esophageal squamous cell carcinomas. Expression is strongly inhibited in the medial septum and hippocampus brain regions of some Alzheimer disease patients.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152061, Expressed in cardiac atrium and 243 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5R372, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5R372, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000152061, Tissue enhanced (heart)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via Rab-GAP TBC domain) with ANK2 (via death domain).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115239, 82 interactors

Protein interaction database and analysis system

More...
IntActi
Q5R372, 39 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000251507

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5R372, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1815
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5R372

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q5R372

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini126 – 282PIDPROSITE-ProRule annotationAdd BLAST157
Domaini538 – 724Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1102, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154611

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007394_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5R372

Identification of Orthologs from Complete Genome Data

More...
OMAi
XDSAQES

Database of Orthologous Groups

More...
OrthoDBi
191811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5R372

TreeFam database of animal gene trees

More...
TreeFami
TF317184

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022164, Kinesin-like
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR000195, Rab-GTPase-TBC_dom
IPR035969, Rab-GTPase_TBC_sf
IPR042809, RABGAP1L

The PANTHER Classification System

More...
PANTHERi
PTHR47219, PTHR47219, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473, DUF3694, 1 hit
PF00566, RabGAP-TBC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462, PTB, 1 hit
SM00164, TBC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47923, SSF47923, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01179, PID, 1 hit
PS50086, TBC_RABGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 12 Publications (identifier: Q5R372-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVRASLQKV SGSSDSVATM NSEEFVLVPQ YADDNSTKHE EKPQLKIVSN
60 70 80 90 100
GDEQLEKAME EILRDSEKRP SSLLVDCQSS SEISDHSFGD IPASQTNKPS
110 120 130 140 150
LQLILDPSNT EISTPRPSSP GGLPEEDSVL FNKLTYLGCM KVSSPRNEVE
160 170 180 190 200
ALRAMATMKS SSQYPFPVTL YVPNVPEGSV RIIDQSSNVE IASFPIYKVL
210 220 230 240 250
FCARGHDGTT ESNCFAFTES SHGSEEFQIH VFSCEIKEAV SRILYSFCTA
260 270 280 290 300
FKRSSRQVSD VKDSVIPTPD SDVFTFSVSL EVKEDDGKGN FSPVPKDRDK
310 320 330 340 350
FYFKLKQGIE KKVVITVQQL SNKELAIERC FGMLLSPGRN VKNSDMHLLD
360 370 380 390 400
MESMGKSYDG RAYVITGMWN PNAPVFLALN EETPKDKQVY MTVAVDMVVT
410 420 430 440 450
EVVEPVRFLL ETVVRVYPAN ERFWYFSRKT FTETFFMRLK QSEGKGHTNA
460 470 480 490 500
GDAIYEVVSL QRESDKEEPV TPTSGGGPMS PQDDEAEEES DNELSSGTGD
510 520 530 540 550
VSKDCPEKIL YSWGELLGKW HSNLGARPKG LSTLVKSGVP EALRAEVWQL
560 570 580 590 600
LAGCHDNQAM LDRYRILITK DSAQESVITR DIHRTFPAHD YFKDTGGDGQ
610 620 630 640 650
ESLYKICKAY SVYDEDIGYC QGQSFLAAVL LLHMPEEQAF CVLVKIMYDY
660 670 680 690 700
GLRDLYRNNF EDLHCKFYQL ERLMQEQLPD LHSHFSDLNL EAHMYASQWF
710 720 730 740 750
LTLFTAKFPL CMVFHIIDLL LCEGLNIIFH VALALLKTSK EDLLQADFEG
760 770 780 790 800
ALKFFRVQLP KRYRAEENAR RLMEQACNIK VPTKKLKKYE KEYQTMRESQ
810
LQQEDPMDRY KFVYL
Length:815
Mass (Da):92,513
Last modified:February 5, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6928AEB23DDD0D3E
GO
Isoform 22 Publications (identifier: Q5R372-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-46: Missing.
     571-642: DSAQESVITR...HMPEEQAFCV → QQMKFSLTPR...HQLIKRLNAC
     643-815: Missing.

Show »
Length:605
Mass (Da):68,003
Checksum:i27D108AFBD84ECAE
GO
Isoform 31 Publication (identifier: Q5R372-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-291: F → FRLLVIPIPFEYF

Show »
Length:827
Mass (Da):94,002
Checksum:i582761A7A13A7536
GO
Isoform 41 Publication (identifier: Q5R372-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     478-492: Missing.

Show »
Length:800
Mass (Da):90,838
Checksum:iC9187DB88D4ADBAC
GO
Isoform 52 Publications (identifier: Q5R372-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-673: Missing.
     675-675: Q → K
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:378
Mass (Da):43,888
Checksum:i5549EF6C459572FC
GO
Isoform 62 Publications (identifier: Q5R372-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-673: Missing.
     674-675: MQ → M
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:377
Mass (Da):43,760
Checksum:iED96B4D7B41949FB
GO
Isoform 72 Publications (identifier: Q5R372-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-693: Missing.
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:358
Mass (Da):41,545
Checksum:iFAAB837F33FB4638
GO
Isoform 82 Publications (identifier: Q5R372-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-681: Missing.
     682-737: HSHFSDLNLE...IFHVALALLK → MEEGVPCPAP...HRLFVPRLLA
     812-815: FVYL → RENRRLQEAS...PVTQPPKEST

Show »
Length:370
Mass (Da):42,689
Checksum:i857D468A7E83B240
GO
Isoform 91 Publication (identifier: Q5R372-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-743: Missing.
     744-780: LQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK → MMEEISIMVAYDAHVFSQLHDEDFLTSLVAISKPRSM

Show »
Length:72
Mass (Da):8,667
Checksum:iE61821538DEB443B
GO
Isoform 10 (identifier: B7ZAP0-1) [UniParc]FASTAAdd to basket
Also known as: D
The sequence of this isoform can be found in the external entry B7ZAP0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:253
Mass (Da):29,038
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DG54A0A0C4DG54_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
582Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQY6A0A0U1RQY6_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNV2E9PNV2_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQT5A0A0U1RQT5_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRM5A0A0U1RRM5_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
252Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8L0F5H8L0_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
308Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PS63E9PS63_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQX4A0A0U1RQX4_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQV7A0A0U1RQV7_HUMAN
Rab GTPase-activating protein 1-lik...
RABGAP1L
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32316 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti311K → R in BAC04635 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052533277S → G. Corresponds to variant dbSNP:rs7339904Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0529121 – 743Missing in isoform 9. 2 PublicationsAdd BLAST743
Alternative sequenceiVSP_0529131 – 693Missing in isoform 7. 2 PublicationsAdd BLAST693
Alternative sequenceiVSP_0529141 – 681Missing in isoform 8. 2 PublicationsAdd BLAST681
Alternative sequenceiVSP_0529151 – 673Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST673
Alternative sequenceiVSP_05291610 – 46Missing in isoform 2. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_052917291F → FRLLVIPIPFEYF in isoform 3. 2 Publications1
Alternative sequenceiVSP_052918478 – 492Missing in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_052919571 – 642DSAQE…QAFCV → QQMKFSLTPRQTIHLVKYEG SMKVSMTPCNQLQFDIRLDV LITYTFCFSSFPEPELYKYV LKHQLIKRLNAC in isoform 2. 2 PublicationsAdd BLAST72
Alternative sequenceiVSP_052920643 – 815Missing in isoform 2. 2 PublicationsAdd BLAST173
Alternative sequenceiVSP_052921674 – 675MQ → M in isoform 6. 2 Publications2
Alternative sequenceiVSP_035087675Q → K in isoform 5. 1 Publication1
Alternative sequenceiVSP_052922682 – 737HSHFS…LALLK → MEEGVPCPAPAAKLTPPVKK SQDMHDERSKLVNEYACRVL ELLGMGHRLFVPRLLA in isoform 8. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_052923744 – 780LQADF…ACNIK → MMEEISIMVAYDAHVFSQLH DEDFLTSLVAISKPRSM in isoform 9. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_052924812 – 815FVYL → RENRRLQEASMRLEQENDDL AHELVTSKIALRNDLDQAED KADVLNKELLLTKQRLVETE EEKRKQEEETAQLKEVFRKQ LEKAEYEIKKTTAIIAEYKQ ICSQLSTRLEKQQAASKEEL EVVKGKMMACKHCSDIFSKE GALKLAATGREDQGIETDDE KDSLKKQLREMELELAQTKL QLVEAKCKIQELEHQRGALM NEIQAAKNSWFSKTLNSIKT ATGTQPLQPAPVTQPPKEST in isoform 5, isoform 6, isoform 7 and isoform 8. 3 Publications4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB019489 mRNA Translation: BAA77330.1
AB019491 mRNA Translation: BAA77332.1
AB019492 mRNA Translation: BAA77333.2
AB019493 mRNA Translation: BAA77334.1
AB007940 mRNA Translation: BAA32316.2 Different initiation.
AL049702 mRNA Translation: CAB41266.1
AL157958 mRNA Translation: CAB76100.1
AK095838 mRNA Translation: BAC04635.1
AL021069 AL031286 Genomic DNA Translation: CAI23486.1
AL022171, AL022400, AL031286 Genomic DNA Translation: CAI20382.1
AL022171 AL031286 Genomic DNA Translation: CAI20383.1
AL022171 Z99127 Genomic DNA Translation: CAI20384.1
AL022400, AL022171, AL031286 Genomic DNA Translation: CAI22876.1
AL022400 AL031286 Genomic DNA Translation: CAI22877.1
AL022400 Z99127 Genomic DNA Translation: CAI22878.1
AL031286, AL022171, AL022400 Genomic DNA Translation: CAI22380.1
AL031286 AL022400 Genomic DNA Translation: CAI22381.1
AL031286 Z99127 Genomic DNA Translation: CAI22382.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22932.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22933.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22934.1
AL136377 Z99127 Genomic DNA Translation: CAI22935.1
AL161671, Z99127 Genomic DNA Translation: CAI16277.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16278.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16279.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16280.1
AL161671 Z99127 Genomic DNA Translation: CAI16281.1
AL591108 Z99127 Genomic DNA Translation: CAH70225.1
Z99127, AL161671 Genomic DNA Translation: CAI18933.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18934.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18935.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18936.1
Z99127 AL591108 Genomic DNA Translation: CAI18937.1
CH471067 Genomic DNA Translation: EAW90977.1
CH471067 Genomic DNA Translation: EAW90979.1
BC012094 mRNA Translation: AAH12094.1
BC018630 mRNA Translation: AAH18630.2
BC041888 mRNA Translation: AAH41888.1
AY364260 mRNA Translation: AAQ76819.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1314.1 [Q5R372-1]
CCDS41437.1 [Q5R372-9]
CCDS58046.1 [Q5R372-8]

NCBI Reference Sequences

More...
RefSeqi
NP_001030307.1, NM_001035230.2 [Q5R372-9]
NP_001230692.1, NM_001243763.1 [Q5R372-9]
NP_001230694.1, NM_001243765.1 [Q5R372-8]
NP_055672.3, NM_014857.4 [Q5R372-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251507; ENSP00000251507; ENSG00000152061 [Q5R372-1]
ENST00000325589; ENSP00000318603; ENSG00000152061 [Q5R372-7]
ENST00000347255; ENSP00000281844; ENSG00000152061 [Q5R372-5]
ENST00000357444; ENSP00000350027; ENSG00000152061 [Q5R372-2]
ENST00000367687; ENSP00000356660; ENSG00000152061 [Q5R372-6]
ENST00000478442; ENSP00000434600; ENSG00000152061 [Q5R372-9]
ENST00000486220; ENSP00000432490; ENSG00000152061 [Q5R372-9]
ENST00000489615; ENSP00000420660; ENSG00000152061 [Q5R372-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9910

UCSC genome browser

More...
UCSCi
uc001gjw.4, human [Q5R372-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB019489 mRNA Translation: BAA77330.1
AB019491 mRNA Translation: BAA77332.1
AB019492 mRNA Translation: BAA77333.2
AB019493 mRNA Translation: BAA77334.1
AB007940 mRNA Translation: BAA32316.2 Different initiation.
AL049702 mRNA Translation: CAB41266.1
AL157958 mRNA Translation: CAB76100.1
AK095838 mRNA Translation: BAC04635.1
AL021069 AL031286 Genomic DNA Translation: CAI23486.1
AL022171, AL022400, AL031286 Genomic DNA Translation: CAI20382.1
AL022171 AL031286 Genomic DNA Translation: CAI20383.1
AL022171 Z99127 Genomic DNA Translation: CAI20384.1
AL022400, AL022171, AL031286 Genomic DNA Translation: CAI22876.1
AL022400 AL031286 Genomic DNA Translation: CAI22877.1
AL022400 Z99127 Genomic DNA Translation: CAI22878.1
AL031286, AL022171, AL022400 Genomic DNA Translation: CAI22380.1
AL031286 AL022400 Genomic DNA Translation: CAI22381.1
AL031286 Z99127 Genomic DNA Translation: CAI22382.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22932.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22933.1
AL136377, AL161671, Z99127 Genomic DNA Translation: CAI22934.1
AL136377 Z99127 Genomic DNA Translation: CAI22935.1
AL161671, Z99127 Genomic DNA Translation: CAI16277.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16278.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16279.1
AL161671, AL136377, Z99127 Genomic DNA Translation: CAI16280.1
AL161671 Z99127 Genomic DNA Translation: CAI16281.1
AL591108 Z99127 Genomic DNA Translation: CAH70225.1
Z99127, AL161671 Genomic DNA Translation: CAI18933.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18934.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18935.1
Z99127, AL136377, AL161671 Genomic DNA Translation: CAI18936.1
Z99127 AL591108 Genomic DNA Translation: CAI18937.1
CH471067 Genomic DNA Translation: EAW90977.1
CH471067 Genomic DNA Translation: EAW90979.1
BC012094 mRNA Translation: AAH12094.1
BC018630 mRNA Translation: AAH18630.2
BC041888 mRNA Translation: AAH41888.1
AY364260 mRNA Translation: AAQ76819.1
CCDSiCCDS1314.1 [Q5R372-1]
CCDS41437.1 [Q5R372-9]
CCDS58046.1 [Q5R372-8]
RefSeqiNP_001030307.1, NM_001035230.2 [Q5R372-9]
NP_001230692.1, NM_001243763.1 [Q5R372-9]
NP_001230694.1, NM_001243765.1 [Q5R372-8]
NP_055672.3, NM_014857.4 [Q5R372-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HZJX-ray2.30A/B/C507-815[»]
SMRiQ5R372
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115239, 82 interactors
IntActiQ5R372, 39 interactors
STRINGi9606.ENSP00000251507

PTM databases

iPTMnetiQ5R372
MetOSiteiQ5R372
PhosphoSitePlusiQ5R372

Polymorphism and mutation databases

BioMutaiRABGAP1L
DMDMi205829393

Proteomic databases

jPOSTiQ5R372
MassIVEiQ5R372
MaxQBiQ5R372
PaxDbiQ5R372
PeptideAtlasiQ5R372
PRIDEiQ5R372
ProteomicsDBi63709 [Q5R372-1]
63710 [Q5R372-2]
63711 [Q5R372-3]
63712 [Q5R372-4]
63713 [Q5R372-5]
63714 [Q5R372-6]
63715 [Q5R372-7]
63716 [Q5R372-8]
63717 [Q5R372-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34402, 70 antibodies

Genome annotation databases

EnsembliENST00000251507; ENSP00000251507; ENSG00000152061 [Q5R372-1]
ENST00000325589; ENSP00000318603; ENSG00000152061 [Q5R372-7]
ENST00000347255; ENSP00000281844; ENSG00000152061 [Q5R372-5]
ENST00000357444; ENSP00000350027; ENSG00000152061 [Q5R372-2]
ENST00000367687; ENSP00000356660; ENSG00000152061 [Q5R372-6]
ENST00000478442; ENSP00000434600; ENSG00000152061 [Q5R372-9]
ENST00000486220; ENSP00000432490; ENSG00000152061 [Q5R372-9]
ENST00000489615; ENSP00000420660; ENSG00000152061 [Q5R372-8]
GeneIDi9910
UCSCiuc001gjw.4, human [Q5R372-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9910
DisGeNETi9910
EuPathDBiHostDB:ENSG00000152061.22

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RABGAP1L
HGNCiHGNC:24663, RABGAP1L
HPAiENSG00000152061, Tissue enhanced (heart)
MIMi601626, phenotype
609238, gene
neXtProtiNX_Q5R372
OpenTargetsiENSG00000152061
PharmGKBiPA134940645

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1102, Eukaryota
GeneTreeiENSGT00940000154611
HOGENOMiCLU_007394_1_1_1
InParanoidiQ5R372
OMAiXDSAQES
OrthoDBi191811at2759
PhylomeDBiQ5R372
TreeFamiTF317184

Enzyme and pathway databases

PathwayCommonsiQ5R372

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9910, 10 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RABGAP1L, human
EvolutionaryTraceiQ5R372

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9910
PharosiQ5R372, Tbio
RNActiQ5R372, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152061, Expressed in cardiac atrium and 243 other tissues
ExpressionAtlasiQ5R372, baseline and differential
GenevisibleiQ5R372, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR022164, Kinesin-like
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR000195, Rab-GTPase-TBC_dom
IPR035969, Rab-GTPase_TBC_sf
IPR042809, RABGAP1L
PANTHERiPTHR47219, PTHR47219, 1 hit
PfamiView protein in Pfam
PF12473, DUF3694, 1 hit
PF00566, RabGAP-TBC, 1 hit
SMARTiView protein in SMART
SM00462, PTB, 1 hit
SM00164, TBC, 1 hit
SUPFAMiSSF47923, SSF47923, 2 hits
PROSITEiView protein in PROSITE
PS01179, PID, 1 hit
PS50086, TBC_RABGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBG1L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5R372
Secondary accession number(s): O75059
, Q3ZTR8, Q5R369, Q8IVV0, Q8N921, Q8WV78, Q9NSP8, Q9UQ19, Q9UQP5, Q9Y6Y5, Q9Y6Y6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: February 5, 2008
Last modified: August 12, 2020
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again