Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5QGZ9 (CL12A_HUMAN)

Entry version 124 (12 Aug 2020)
Sequence version 3 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

C-type lectin domain family 12 member A

Gene

CLEC12A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
LigandLectin

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5QGZ9

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6798695, Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-type lectin domain family 12 member A
Alternative name(s):
C-type lectin-like molecule 1
Short name:
CLL-1
Dendritic cell-associated lectin 2
Short name:
DCAL-2
Myeloid inhibitory C-type lectin-like receptor
Short name:
MICL
CD_antigen: CD371
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLEC12A
Synonyms:CLL1, DCAL2, MICL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000172322.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:31713, CLEC12A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612088, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5QGZ9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 43CytoplasmicSequence analysisAdd BLAST43
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei44 – 64Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini65 – 265ExtracellularSequence analysisAdd BLAST201

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		160364

Open Targets

More...OpenTargetsi		ENSG00000172322

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142672094

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5QGZ9, Tbio

Chemistry databases

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		3081

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CLEC12A

Domain mapping of disease mutations (DMDM)

More...DMDMi		308153619

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003135781 – 265C-type lectin domain family 12 member AAdd BLAST265

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi88N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi98N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi161 ↔ 248PROSITE-ProRule annotation
Glycosylationi165N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi227 ↔ 240PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly N-glycosylated. Glycosylation varies between cell types.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5QGZ9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5QGZ9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5QGZ9

PeptideAtlas

More...PeptideAtlasi		Q5QGZ9

PRoteomics IDEntifications database

More...PRIDEi		Q5QGZ9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		63611 [Q5QGZ9-2]
63612 [Q5QGZ9-1]
63613 [Q5QGZ9-3]
63614 [Q5QGZ9-4]
63615 [Q5QGZ9-5]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q5QGZ9, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5QGZ9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5QGZ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in normal myeloid cells and in acute myeloid leukemia cells. Detected in neutrophils, eosinophils, monocytes and dendritic cells. Detected in spleen macrophage-rich red pulp and in lymph node (at protein level). Detected in peripheral blood leukocytes, dendritic cells, bone marrow, monocytes, mononuclear leukocytes and macrophages.4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in activated leukocytes recruited to a site of inflammation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000172322, Expressed in monocyte and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5QGZ9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5QGZ9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000172322, Group enriched (blood, bone marrow, lung, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PTPN6 and PTPN11.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		127754, 29 interactors

Protein interaction database and analysis system

More...IntActi		Q5QGZ9, 24 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000347916

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5QGZ9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5QGZ9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini140 – 249C-type lectinPROSITE-ProRule annotationAdd BLAST110

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi5 – 10ITIM motif6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4297, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162719

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5QGZ9

KEGG Orthology (KO)

More...KOi		K17516

Identification of Orthologs from Complete Genome Data

More...OMAi		WHEDSCY

Database of Orthologous Groups

More...OrthoDBi		1201127at2759

TreeFam database of animal gene trees

More...TreeFami		TF336674

Family and domain databases

Conserved Domains Database

More...CDDi		cd03593, CLECT_NK_receptors_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR016187, CTDL_fold
IPR033992, NKR-like_CTLD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00059, Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00034, CLECT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56436, SSF56436, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50041, C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: Q5QGZ9-2) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEEVTYADL QFQNSSEMEK IPEIGKFGEK APPAPSHVWR PAALFLTLLC 
        60         70         80         90        100
LLLLIGLGVL ASMFHVTLKI EMKKMNKLQN ISEELQRNIS LQLMSNMNIS 
       110        120        130        140        150
NKIRNLSTTL QTIATKLCRE LYSKEQEHKC KPCPRRWIWH KDSCYFLSDD 
       160        170        180        190        200
VQTWQESKMA CAAQNASLLK INNKNALEFI KSQSRSYDYW LGLSPEEDST 
       210        220        230        240        250
RGMRVDNIIN SSAWVIRNAP DLNNMYCGYI NRLYVQYYHC TYKKRMICEK 
       260 
MANPVQLGST YFREA
Length:265
Mass (Da):30,762
Last modified:October 5, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4255FF1EA9F0D4B1
GO
Isoform 1 (identifier: Q5QGZ9-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWIDFFTYSSM

Show »
Length:275
Mass (Da):32,040
Checksum:i71AA82DBDD039848
GO
Isoform 3 (identifier: Q5QGZ9-3) [UniParc]FASTAAdd to basket
Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     64-81: FHVTLKIEMKKMNKLQNI → CMYCPCFGQEEVSRISNI
     82-265: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:81
Mass (Da):8,965
Checksum:iF025075C173112DD
GO
Isoform 4 (identifier: Q5QGZ9-4) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     31-64: APPAPSHVWRPAALFLTLLCLLLLIGLGVLASMF → V

Show »
Length:232
Mass (Da):27,276
Checksum:i3BF3147C5CEB4B45
GO
Isoform 5 (identifier: Q5QGZ9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-265: Missing.

Show »
Length:213
Mass (Da):24,449
Checksum:iD026446C70B23B77
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MVL9A8MVL9_HUMAN
C-type lectin domain family 12 memb...
CLEC12A
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_037669244K → Q6 PublicationsCorresponds to variant dbSNP:rs479499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0398541M → MWIDFFTYSSM in isoform 1. 1 Publication1
Alternative sequenceiVSP_03003031 – 64APPAP…LASMF → V in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03003164 – 81FHVTL…KLQNI → CMYCPCFGQEEVSRISNI in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_03003282 – 265Missing in isoform 3. 1 PublicationAdd BLAST184
Alternative sequenceiVSP_030033214 – 265Missing in isoform 5. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY547296 mRNA Translation: AAT11783.1
AY498550 mRNA Translation: AAS00605.1
AY498551 mRNA Translation: AAS00606.1
AY498552 mRNA Translation: AAS00607.1
AY426759 mRNA Translation: AAR84594.1
AF247788 mRNA Translation: AAL95693.1
AK314001 mRNA Translation: BAG36713.1
AC091814 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96133.1
BC063424 mRNA Translation: AAH63424.1
BC126289 mRNA Translation: AAI26290.1
BC126291 mRNA Translation: AAI26292.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55803.1 [Q5QGZ9-1]
CCDS73442.1 [Q5QGZ9-5]
CCDS8608.1 [Q5QGZ9-2]
CCDS8609.1 [Q5QGZ9-4]

NCBI Reference Sequences

More...RefSeqi		NP_001193939.1, NM_001207010.1 [Q5QGZ9-1]
NP_001287659.1, NM_001300730.1 [Q5QGZ9-5]
NP_612210.4, NM_138337.5 [Q5QGZ9-2]
NP_963917.2, NM_201623.3 [Q5QGZ9-4]
XP_005253381.1, XM_005253324.2 [Q5QGZ9-2]
XP_011518872.1, XM_011520570.1 [Q5QGZ9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000304361; ENSP00000302804; ENSG00000172322 [Q5QGZ9-2]
ENST00000350667; ENSP00000345448; ENSG00000172322 [Q5QGZ9-4]
ENST00000355690; ENSP00000347916; ENSG00000172322 [Q5QGZ9-1]
ENST00000434319; ENSP00000405244; ENSG00000172322 [Q5QGZ9-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		160364

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:160364

UCSC genome browser

More...UCSCi		uc001qwq.3, human [Q5QGZ9-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY547296 mRNA Translation: AAT11783.1
AY498550 mRNA Translation: AAS00605.1
AY498551 mRNA Translation: AAS00606.1
AY498552 mRNA Translation: AAS00607.1
AY426759 mRNA Translation: AAR84594.1
AF247788 mRNA Translation: AAL95693.1
AK314001 mRNA Translation: BAG36713.1
AC091814 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96133.1
BC063424 mRNA Translation: AAH63424.1
BC126289 mRNA Translation: AAI26290.1
BC126291 mRNA Translation: AAI26292.1
CCDSiCCDS55803.1 [Q5QGZ9-1]
CCDS73442.1 [Q5QGZ9-5]
CCDS8608.1 [Q5QGZ9-2]
CCDS8609.1 [Q5QGZ9-4]
RefSeqiNP_001193939.1, NM_001207010.1 [Q5QGZ9-1]
NP_001287659.1, NM_001300730.1 [Q5QGZ9-5]
NP_612210.4, NM_138337.5 [Q5QGZ9-2]
NP_963917.2, NM_201623.3 [Q5QGZ9-4]
XP_005253381.1, XM_005253324.2 [Q5QGZ9-2]
XP_011518872.1, XM_011520570.1 [Q5QGZ9-2]

3D structure databases

SMRiQ5QGZ9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127754, 29 interactors
IntActiQ5QGZ9, 24 interactors
STRINGi9606.ENSP00000347916

Chemistry databases

GuidetoPHARMACOLOGYi3081

PTM databases

GlyGeniQ5QGZ9, 3 sites
iPTMnetiQ5QGZ9
PhosphoSitePlusiQ5QGZ9

Polymorphism and mutation databases

BioMutaiCLEC12A
DMDMi308153619

Proteomic databases

jPOSTiQ5QGZ9
MassIVEiQ5QGZ9
PaxDbiQ5QGZ9
PeptideAtlasiQ5QGZ9
PRIDEiQ5QGZ9
ProteomicsDBi63611 [Q5QGZ9-2]
63612 [Q5QGZ9-1]
63613 [Q5QGZ9-3]
63614 [Q5QGZ9-4]
63615 [Q5QGZ9-5]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q5QGZ9, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11635, 372 antibodies

The DNASU plasmid repository

More...DNASUi		160364

Genome annotation databases

EnsembliENST00000304361; ENSP00000302804; ENSG00000172322 [Q5QGZ9-2]
ENST00000350667; ENSP00000345448; ENSG00000172322 [Q5QGZ9-4]
ENST00000355690; ENSP00000347916; ENSG00000172322 [Q5QGZ9-1]
ENST00000434319; ENSP00000405244; ENSG00000172322 [Q5QGZ9-5]
GeneIDi160364
KEGGihsa:160364
UCSCiuc001qwq.3, human [Q5QGZ9-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		160364
DisGeNETi160364
EuPathDBiHostDB:ENSG00000172322.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		CLEC12A
HGNCiHGNC:31713, CLEC12A
HPAiENSG00000172322, Group enriched (blood, bone marrow, lung, lymphoid tissue)
MIMi612088, gene
neXtProtiNX_Q5QGZ9
OpenTargetsiENSG00000172322
PharmGKBiPA142672094

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4297, Eukaryota
GeneTreeiENSGT00940000162719
InParanoidiQ5QGZ9
KOiK17516
OMAiWHEDSCY
OrthoDBi1201127at2759
TreeFamiTF336674

Enzyme and pathway databases

PathwayCommonsiQ5QGZ9
ReactomeiR-HSA-6798695, Neutrophil degranulation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		160364, 4 hits in 865 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CLEC12A, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CLEC12A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		160364
PharosiQ5QGZ9, Tbio

Protein Ontology

More...PROi		PR:Q5QGZ9
RNActiQ5QGZ9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000172322, Expressed in monocyte and 129 other tissues
ExpressionAtlasiQ5QGZ9, baseline and differential
GenevisibleiQ5QGZ9, HS

Family and domain databases

CDDicd03593, CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR016187, CTDL_fold
IPR033992, NKR-like_CTLD
PfamiView protein in Pfam
PF00059, Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034, CLECT, 1 hit
SUPFAMiSSF56436, SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041, C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCL12A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5QGZ9
Secondary accession number(s): B2RA16
, Q6P4H1, Q6RH77, Q6RH78, Q8TDQ6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: October 5, 2010
Last modified: August 12, 2020
This is version 124 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again