Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 102 (31 Jul 2019)
Sequence version 1 (04 Jan 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium/bile acid cotransporter 7

Gene

Slc10a7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Does not show transport activity towards bile acids or steroid sulfates (including taurocholate, cholate, chenodeoxycholate, estrone-3-sulfate, dehydroepiandrosterone sulfate (DHEAS) and pregnenolone sulfate).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/bile acid cotransporter 7
Alternative name(s):
Na(+)/bile acid cotransporter 7
Solute carrier family 10 member 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc10a7
Synonyms:P7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924025 Slc10a7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 10CytoplasmicBy similarity10
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei11 – 31HelicalSequence analysisAdd BLAST21
Topological domaini32 – 37ExtracellularBy similarity6
Transmembranei38 – 58HelicalSequence analysisAdd BLAST21
Topological domaini59 – 71CytoplasmicBy similarityAdd BLAST13
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 116ExtracellularBy similarityAdd BLAST24
Transmembranei117 – 137HelicalSequence analysisAdd BLAST21
Topological domaini138CytoplasmicBy similarity1
Transmembranei139 – 159HelicalSequence analysisAdd BLAST21
Topological domaini160 – 163ExtracellularBy similarity4
Transmembranei164 – 184HelicalSequence analysisAdd BLAST21
Topological domaini185 – 201CytoplasmicBy similarityAdd BLAST17
Transmembranei202 – 222HelicalSequence analysisAdd BLAST21
Topological domaini223 – 234ExtracellularBy similarityCuratedAdd BLAST12
Transmembranei235 – 255HelicalSequence analysisAdd BLAST21
Topological domaini256 – 270CytoplasmicBy similarityAdd BLAST15
Transmembranei271 – 291HelicalSequence analysisAdd BLAST21
Topological domaini292 – 298ExtracellularBy similarity7
Transmembranei299 – 319HelicalSequence analysisAdd BLAST21
Topological domaini320 – 340CytoplasmicBy similarityAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002782511 – 340Sodium/bile acid cotransporter 7Add BLAST340

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5PT53

PRoteomics IDEntifications database

More...
PRIDEi
Q5PT53

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5PT53

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, brain, colon, lung, liver, adrenal gland, stomach and ovary. Also expressed weakly in small intestine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031684 Expressed in 207 organ(s), highest expression level in humerus cartilage element

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5PT53 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5PT53 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000034111

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4821 Eukaryota
COG0385 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006888

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5PT53

KEGG Orthology (KO)

More...
KOi
K14347

Identification of Orthologs from Complete Genome Data

More...
OMAi
FFFYGLK

Database of Orthologous Groups

More...
OrthoDBi
949808at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5PT53

TreeFam database of animal gene trees

More...
TreeFami
TF329411

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1530.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038770 Na+/solute_symporter_sf
IPR016833 Put_Na-Bile_cotransptr

The PANTHER Classification System

More...
PANTHERi
PTHR18640 PTHR18640, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13593 SBF_like, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF026166 UCP026166, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5PT53-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLLERARKE WFMVGIVVAI GAAKLEPSVG VNGGPLKPEI TVSYIAVATI
60 70 80 90 100
FFNSGLSLKT EELTSALVHL RLHLFIQIFT LAFFPAAIWL FLQLLSVTSI
110 120 130 140 150
NEWLLKGLQT VGCMPPPVSS AVILTKAVGG NEAAAIFNSA FGSFLGIVVT
160 170 180 190 200
PVLLLLFLGS SSSVPFTSIF SQLFMTVVVP LVIGQIVRRY IKDWLERKKP
210 220 230 240 250
PFGVVSSSVL LMIIYTTFCD TFSNPNIDLD KFSLILILFI IVSVQLSFML
260 270 280 290 300
LTFIFSTRNN SGFTPADTVA IIFCSTHKSL TLGIPMLKIV FAGHEHLSLI
310 320 330 340
SVPLLIYHPA QILLGSVLVP TIKSWMVSRQ KGVKLTRPTV
Length:340
Mass (Da):37,256
Last modified:January 4, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE373F9E2F4848A5C
GO
Isoform 2 (identifier: Q5PT53-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-283: IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLG → R

Show »
Length:298
Mass (Da):32,750
Checksum:i4C1F9F22563BE1F6
GO
Isoform 3 (identifier: Q5PT53-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-185: Missing.

Show »
Length:312
Mass (Da):34,332
Checksum:i5CB5CE6967BD547F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GR66A0A1B0GR66_MOUSE
Sodium/bile acid cotransporter 7
Slc10a7
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5PT52Q5PT52_MOUSE
Sodium/bile acid cotransporter 7
Slc10a7 P7
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC30613 differs from that shown. Reason: Erroneous termination at position 172. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti144F → V in BAB27214 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_023225158 – 185Missing in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_023226241 – 283IVSVQ…SLTLG → R in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY825926 mRNA Translation: AAV80709.1
AY825928 mRNA Translation: AAV80711.1
AK010834 mRNA Translation: BAB27214.1
AK040517 mRNA Translation: BAC30613.1 Sequence problems.
AK079901 mRNA Translation: BAC37779.1
AK152752 mRNA Translation: BAE31467.1
AK152849 mRNA Translation: BAE31542.1
BC116666 mRNA Translation: AAI16667.1
BC116717 mRNA Translation: AAI16718.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40395.1 [Q5PT53-1]
CCDS85567.1 [Q5PT53-2]
CCDS85568.1 [Q5PT53-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001009981.1, NM_001009981.2 [Q5PT53-3]
NP_001269037.1, NM_001282108.1 [Q5PT53-2]
NP_084012.1, NM_029736.2 [Q5PT53-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684 [Q5PT53-1]
ENSMUST00000209490; ENSMUSP00000148199; ENSMUSG00000031684 [Q5PT53-2]
ENSMUST00000209992; ENSMUSP00000147659; ENSMUSG00000031684 [Q5PT53-3]
ENSMUST00000211286; ENSMUSP00000147724; ENSMUSG00000031684 [Q5PT53-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
76775

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:76775

UCSC genome browser

More...
UCSCi
uc009mid.2 mouse [Q5PT53-1]
uc012ggi.2 mouse [Q5PT53-3]
uc012ggk.2 mouse [Q5PT53-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825926 mRNA Translation: AAV80709.1
AY825928 mRNA Translation: AAV80711.1
AK010834 mRNA Translation: BAB27214.1
AK040517 mRNA Translation: BAC30613.1 Sequence problems.
AK079901 mRNA Translation: BAC37779.1
AK152752 mRNA Translation: BAE31467.1
AK152849 mRNA Translation: BAE31542.1
BC116666 mRNA Translation: AAI16667.1
BC116717 mRNA Translation: AAI16718.1
CCDSiCCDS40395.1 [Q5PT53-1]
CCDS85567.1 [Q5PT53-2]
CCDS85568.1 [Q5PT53-3]
RefSeqiNP_001009981.1, NM_001009981.2 [Q5PT53-3]
NP_001269037.1, NM_001282108.1 [Q5PT53-2]
NP_084012.1, NM_029736.2 [Q5PT53-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034111

PTM databases

PhosphoSitePlusiQ5PT53

Proteomic databases

PaxDbiQ5PT53
PRIDEiQ5PT53

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034111; ENSMUSP00000034111; ENSMUSG00000031684 [Q5PT53-1]
ENSMUST00000209490; ENSMUSP00000148199; ENSMUSG00000031684 [Q5PT53-2]
ENSMUST00000209992; ENSMUSP00000147659; ENSMUSG00000031684 [Q5PT53-3]
ENSMUST00000211286; ENSMUSP00000147724; ENSMUSG00000031684 [Q5PT53-1]
GeneIDi76775
KEGGimmu:76775
UCSCiuc009mid.2 mouse [Q5PT53-1]
uc012ggi.2 mouse [Q5PT53-3]
uc012ggk.2 mouse [Q5PT53-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84068
MGIiMGI:1924025 Slc10a7

Phylogenomic databases

eggNOGiKOG4821 Eukaryota
COG0385 LUCA
GeneTreeiENSGT00390000011932
HOGENOMiHOG000006888
InParanoidiQ5PT53
KOiK14347
OMAiFFFYGLK
OrthoDBi949808at2759
PhylomeDBiQ5PT53
TreeFamiTF329411

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q5PT53

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031684 Expressed in 207 organ(s), highest expression level in humerus cartilage element
ExpressionAtlasiQ5PT53 baseline and differential
GenevisibleiQ5PT53 MM

Family and domain databases

Gene3Di1.20.1530.20, 1 hit
InterProiView protein in InterPro
IPR038770 Na+/solute_symporter_sf
IPR016833 Put_Na-Bile_cotransptr
PANTHERiPTHR18640 PTHR18640, 1 hit
PfamiView protein in Pfam
PF13593 SBF_like, 1 hit
PIRSFiPIRSF026166 UCP026166, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNTCP7_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5PT53
Secondary accession number(s): Q5PT51
, Q8BV58, Q8BYD0, Q9CWD6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 4, 2005
Last modified: July 31, 2019
This is version 102 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again