Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (02 Jun 2021)
Sequence version 1 (01 Feb 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Protein cordon-bleu

Gene

Cobl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the reorganization of the actin cytoskeleton. Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells.

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein cordon-bleu
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cobl
Synonyms:Kiaa0633
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:105056, Cobl

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002604921 – 1337Protein cordon-bleuAdd BLAST1337

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei47PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei212PhosphoserineBy similarity1
Modified residuei235PhosphoserineBy similarity1
Modified residuei272PhosphoserineCombined sources1
Modified residuei294PhosphoserineBy similarity1
Modified residuei346PhosphoserineBy similarity1
Modified residuei349PhosphoserineBy similarity1
Modified residuei372PhosphoserineBy similarity1
Modified residuei522PhosphothreonineCombined sources1
Modified residuei649PhosphoserineBy similarity1
Modified residuei816PhosphoserineBy similarity1
Modified residuei1038PhosphoserineBy similarity1
Modified residuei1128PhosphoserineCombined sources1
Modified residuei1303PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5NBX1

PeptideAtlas

More...
PeptideAtlasi
Q5NBX1

PRoteomics IDEntifications database

More...
PRIDEi
Q5NBX1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
283337 [Q5NBX1-1]
283338 [Q5NBX1-2]
283339 [Q5NBX1-3]
283340 [Q5NBX1-4]
283341 [Q5NBX1-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5NBX1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5NBX1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain cortex and in the Purkinje cell layer in the cerebellum. Detected in hippocampus neurons, and at lower levels in testis, lung and spleen (at protein level). Detected in embryonic neural tube.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020173, Expressed in muscle tissue and 258 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5NBX1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5NBX1, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in a complex composed of COBL, PACSIN1 and WASL.

Interacts with PACSIN1, PACSIN2 and PACSIN3 (By similarity).

Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X.

Interacts (via WH2 domains) with actin monomers.

Interacts with DBNL.

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

Database of interacting proteins

More...
DIPi
DIP-39834N

Protein interaction database and analysis system

More...
IntActi
Q5NBX1, 7 interactors

Molecular INTeraction database

More...
MINTi
Q5NBX1

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000045693

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5NBX1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11337
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5NBX1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1185 – 1205WH2 1PROSITE-ProRule annotationAdd BLAST21
Domaini1225 – 1245WH2 2PROSITE-ProRule annotationAdd BLAST21
Domaini1313 – 1333WH2 3PROSITE-ProRule annotationAdd BLAST21

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 41DisorderedSequence analysisAdd BLAST41
Regioni260 – 556DisorderedSequence analysisAdd BLAST297
Regioni647 – 768DisorderedSequence analysisAdd BLAST122
Regioni892 – 923DisorderedSequence analysisAdd BLAST32
Regioni967 – 991DisorderedSequence analysisAdd BLAST25
Regioni1070 – 1094DisorderedSequence analysisAdd BLAST25
Regioni1113 – 1133DisorderedSequence analysisAdd BLAST21
Regioni1145 – 1168DisorderedSequence analysisAdd BLAST24
Regioni1192 – 1221DisorderedSequence analysisAdd BLAST30
Regioni1262 – 1310DisorderedSequence analysisAdd BLAST49

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi323 – 328KKRRAP 16
Motifi356 – 361KKRRAP 26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi284 – 316Polar residuesSequence analysisAdd BLAST33
Compositional biasi360 – 375Pro residuesSequence analysisAdd BLAST16
Compositional biasi402 – 427Pro residuesSequence analysisAdd BLAST26
Compositional biasi479 – 498Polar residuesSequence analysisAdd BLAST20
Compositional biasi499 – 513Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi529 – 548Polar residuesSequence analysisAdd BLAST20
Compositional biasi647 – 664Polar residuesSequence analysisAdd BLAST18
Compositional biasi680 – 709Polar residuesSequence analysisAdd BLAST30
Compositional biasi715 – 732Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi1070 – 1092Polar residuesSequence analysisAdd BLAST23
Compositional biasi1196 – 1221Basic and acidic residuesSequence analysisAdd BLAST26
Compositional biasi1273 – 1292Pro residuesSequence analysisAdd BLAST20
Compositional biasi1293 – 1310Polar residuesSequence analysisAdd BLAST18

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTAY, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063608

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_045340_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5NBX1

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVREFWR

Database of Orthologous Groups

More...
OrthoDBi
986623at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5NBX1

TreeFam database of animal gene trees

More...
TreeFami
TF333490

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039895, COBL-like
IPR019025, Cordon-bleu_ubiquitin_domain
IPR003124, WH2_dom

The PANTHER Classification System

More...
PANTHERi
PTHR47008, PTHR47008, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09469, Cobl, 1 hit
PF02205, WH2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00246, WH2, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51082, WH2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5NBX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAPRALAAK PPTGRKMKAR APPPPGKPAA QNVHSEQKLP HDATLGSQQS
60 70 80 90 100
LVYMKEALQN STLDITVVLP SGLEKQSVVS GSHAMMDLLV ELCLQNHLNP
110 120 130 140 150
SHHVLEIWSS ETQQPLSFKP NTLIGSLNVH TVLLKEKVPE ERVKPGLTKA
160 170 180 190 200
PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV NPEHVILLRD
210 220 230 240 250
NVAGEELELS KSLNELGIKE LYAWDNRREM FRKSSLGNDE TDKEKKKFLG
260 270 280 290 300
FFKANKRSNS KAEHLGLSGA DSDEDPAKSA SGGDLNGCVT TPNSPSLHSR
310 320 330 340 350
SLTLGPSLSL GNISGVSMKS DMKKRRAPPP PSPKLLGQDK VSEKASLSSQ
360 370 380 390 400
ADLQKKKRRA PAPPPPQQPP PSPVVPNRKE DKEENRKSTV GVGRQVPQKP
410 420 430 440 450
PRGTARGPPQ LVLPPPPPYP PPDTDVTEPV TFPGEGAGSE TSELRPKLSL
460 470 480 490 500
PLGPGSHCSM GGVSQVPAES EETASEDTTE DSGVMSSPSD AISLDSQQDS
510 520 530 540 550
MRSKDKWSTD QEDGSDQDLA GTPELGPQKS PSWGKSGSGS SILRTEKATM
560 570 580 590 600
PTNDDEDLFI TGHLHQTLAE LDEDLEGMEE NYETDTSSLT NSVNGVSNHS
610 620 630 640 650
LQEAIIPDSG VDDIPVTFIG EVSDEPFDSG LFSSRCNNAT TFNTGSIASQ
660 670 680 690 700
RSHLSPSQTE HSQPFVRTSR KEPDPSPPSQ DNRKRNQPTL ANTSENENPV
710 720 730 740 750
ETDPTVTSLV SKLLIDDPKA KDKGKVHGSS HSEKTQAGHG INSLRVNPRD
760 770 780 790 800
GKDESSNSAP PPWSHHGQAL GGSYGLKYGL TTYKIVPPKS EMRCYDRDVS
810 820 830 840 850
LSTGAIKIDE LGNLVSPHMN GSRTISPPSA VVETDTPPIG KVKEFWRRNS
860 870 880 890 900
MEKYLNGPAE CTIKRAPSTT ITATPEKPQQ DNGMKAAFTV TTPQQQPASQ
910 920 930 940 950
EYGAHLEEER SRPQSAVSCS VKVPASNPTD ITFLKPQRRT SSQYVASAIA
960 970 980 990 1000
KKMGPPKVHA DVVRPHKATT EQCHEEAKLA RSPPTRKDDA APNLHSEARQ
1010 1020 1030 1040 1050
HEHGTNQSSV CLPSNPGVQL PAGGHPKVEV NSTYGKSSTQ DYPAAVHRNS
1060 1070 1080 1090 1100
YFLPGRSSHR DRVSVGQSCG FNEKQTTSNQ KANSTSNFSQ ALDKAHPPPL
1110 1120 1130 1140 1150
LLAEARDSGR ILMNGSARTP GNCEPPHSPK ESTLTSYIIL QTEEKPSSLS
1160 1170 1180 1190 1200
TDGQDADDTL PSSIFGPKKK FKPVIQRPLP KDVSLHSALM EAIHSSGGRE
1210 1220 1230 1240 1250
KLRKTAEQTS EGRPKKPSYV EAESERSALL AAIRGHSGTL SLRKVSSLAS
1260 1270 1280 1290 1300
EELQSFRNAA LGAPGLDKPQ QEDLGLPPPP ALPPPPAPAP QAPSASVTVS
1310 1320 1330
RFSTGTPSNS VNARQALMDA IRSGTGAARL RKVPLLV
Length:1,337
Mass (Da):143,865
Last modified:February 1, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4A8D3250294A277
GO
Isoform 2 (identifier: Q5NBX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-286: Missing.
     391-448: GVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGSETSELRPKL → V

Show »
Length:1,255
Mass (Da):135,523
Checksum:i7FCFE31086D86DF1
GO
Isoform 3 (identifier: Q5NBX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:1,321
Mass (Da):142,203
Checksum:iF9453527654F8494
GO
Isoform 4 (identifier: Q5NBX1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     448-469: LSLPLGPGSHCSMGGVSQVPAE → RTCLLLPFQLCVDHLSFWSLLV
     470-1337: Missing.

Show »
Length:469
Mass (Da):51,101
Checksum:i22FCBE456E0F4397
GO
Isoform 5 (identifier: Q5NBX1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-349: ASLSS → VPLLV
     350-1337: Missing.

Show »
Length:349
Mass (Da):38,036
Checksum:i80B82DE94D73CD2F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E8P4G5E8P4_MOUSE
Protein cordon-bleu
Cobl
1,312Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UWY3G3UWY3_MOUSE
Protein cordon-bleu
Cobl
1,330Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RR81F6RR81_MOUSE
Protein cordon-bleu
Cobl
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UZ73G3UZ73_MOUSE
Protein cordon-bleu
Cobl
410Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZEZ1F6ZEZ1_MOUSE
Protein cordon-bleu
Cobl
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UWP1G3UWP1_MOUSE
Protein cordon-bleu
Cobl
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH23264 differs from that shown. Reason: Frameshift.Curated
The sequence BAC65616 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10K → Q in BAC33896 (PubMed:16141072).Curated1
Sequence conflicti18K → R in BAC33896 (PubMed:16141072).Curated1
Sequence conflicti45L → M in BAC26144 (PubMed:16141072).Curated1
Sequence conflicti112T → N in AAP74341 (PubMed:14512015).Curated1
Sequence conflicti128N → S in BAC26144 (PubMed:16141072).Curated1
Sequence conflicti801L → F in AAP74341 (PubMed:14512015).Curated1
Sequence conflicti914Q → R in BAC65616 (PubMed:19468303).Curated1
Sequence conflicti1010V → I in AAH23264 (PubMed:15489334).Curated1
Sequence conflicti1112L → V in AAH23264 (PubMed:15489334).Curated1
Sequence conflicti1205T → V in AAP74341 (PubMed:14512015).Curated1
Sequence conflicti1285P → T in AAP74341 (PubMed:14512015).Curated1
Sequence conflicti1285P → T in AAH23264 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0216141 – 16Missing in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_021615262 – 286Missing in isoform 2. CuratedAdd BLAST25
Alternative sequenceiVSP_021616345 – 349ASLSS → VPLLV in isoform 5. 1 Publication5
Alternative sequenceiVSP_021617350 – 1337Missing in isoform 5. 1 PublicationAdd BLAST988
Alternative sequenceiVSP_021618391 – 448GVGRQ…LRPKL → V in isoform 2. CuratedAdd BLAST58
Alternative sequenceiVSP_021619448 – 469LSLPL…QVPAE → RTCLLLPFQLCVDHLSFWSL LV in isoform 4. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021620470 – 1337Missing in isoform 4. 1 PublicationAdd BLAST868

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY308745 mRNA Translation: AAP74341.1
AK122334 mRNA Translation: BAC65616.1 Different initiation.
AK028833 mRNA Translation: BAC26144.1
AK049730 mRNA Translation: BAC33896.1
AL669822 Genomic DNA No translation available.
AL713914 Genomic DNA No translation available.
BC023264 mRNA Translation: AAH23264.1 Frameshift.
BC060061 mRNA Translation: AAH60061.1
U26967 mRNA Translation: AAA92362.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36113.1 [Q5NBX1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_766084.3, NM_172496.3 [Q5NBX1-1]
XP_006514548.1, XM_006514485.3 [Q5NBX1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000046755; ENSMUSP00000045693; ENSMUSG00000020173 [Q5NBX1-1]
ENSMUST00000109650; ENSMUSP00000105277; ENSMUSG00000020173 [Q5NBX1-2]
ENSMUST00000172919; ENSMUSP00000133669; ENSMUSG00000020173 [Q5NBX1-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12808

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12808

UCSC genome browser

More...
UCSCi
uc007ibd.2, mouse [Q5NBX1-1]
uc007ibf.2, mouse [Q5NBX1-4]
uc011xrq.1, mouse [Q5NBX1-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY308745 mRNA Translation: AAP74341.1
AK122334 mRNA Translation: BAC65616.1 Different initiation.
AK028833 mRNA Translation: BAC26144.1
AK049730 mRNA Translation: BAC33896.1
AL669822 Genomic DNA No translation available.
AL713914 Genomic DNA No translation available.
BC023264 mRNA Translation: AAH23264.1 Frameshift.
BC060061 mRNA Translation: AAH60061.1
U26967 mRNA Translation: AAA92362.1
CCDSiCCDS36113.1 [Q5NBX1-1]
RefSeqiNP_766084.3, NM_172496.3 [Q5NBX1-1]
XP_006514548.1, XM_006514485.3 [Q5NBX1-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3TU5X-ray3.00B1201-1332[»]
4JHDX-ray2.91C/F1176-1337[»]
5YPUX-ray2.00B/D1184-1204[»]
6JBKX-ray2.45B/D/F/H1184-1205[»]
6JCUX-ray2.30B/D1184-1205[»]
6JH8X-ray2.15B1183-1205[»]
6JH9X-ray1.74B1183-1205[»]
SMRiQ5NBX1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

DIPiDIP-39834N
IntActiQ5NBX1, 7 interactors
MINTiQ5NBX1
STRINGi10090.ENSMUSP00000045693

PTM databases

iPTMnetiQ5NBX1
PhosphoSitePlusiQ5NBX1

Proteomic databases

PaxDbiQ5NBX1
PeptideAtlasiQ5NBX1
PRIDEiQ5NBX1
ProteomicsDBi283337 [Q5NBX1-1]
283338 [Q5NBX1-2]
283339 [Q5NBX1-3]
283340 [Q5NBX1-4]
283341 [Q5NBX1-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
13730, 118 antibodies

The DNASU plasmid repository

More...
DNASUi
12808

Genome annotation databases

EnsembliENSMUST00000046755; ENSMUSP00000045693; ENSMUSG00000020173 [Q5NBX1-1]
ENSMUST00000109650; ENSMUSP00000105277; ENSMUSG00000020173 [Q5NBX1-2]
ENSMUST00000172919; ENSMUSP00000133669; ENSMUSG00000020173 [Q5NBX1-5]
GeneIDi12808
KEGGimmu:12808
UCSCiuc007ibd.2, mouse [Q5NBX1-1]
uc007ibf.2, mouse [Q5NBX1-4]
uc011xrq.1, mouse [Q5NBX1-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23242
MGIiMGI:105056, Cobl

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QTAY, Eukaryota
GeneTreeiENSGT00530000063608
HOGENOMiCLU_045340_1_0_1
InParanoidiQ5NBX1
OMAiKVREFWR
OrthoDBi986623at2759
PhylomeDBiQ5NBX1
TreeFamiTF333490

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
12808, 0 hits in 52 CRISPR screens

Protein Ontology

More...
PROi
PR:Q5NBX1
RNActiQ5NBX1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020173, Expressed in muscle tissue and 258 other tissues
ExpressionAtlasiQ5NBX1, baseline and differential
GenevisibleiQ5NBX1, MM

Family and domain databases

InterProiView protein in InterPro
IPR039895, COBL-like
IPR019025, Cordon-bleu_ubiquitin_domain
IPR003124, WH2_dom
PANTHERiPTHR47008, PTHR47008, 1 hit
PfamiView protein in Pfam
PF09469, Cobl, 1 hit
PF02205, WH2, 3 hits
SMARTiView protein in SMART
SM00246, WH2, 3 hits
PROSITEiView protein in PROSITE
PS51082, WH2, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOBL_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5NBX1
Secondary accession number(s): Q5NBX2
, Q60859, Q6PAT4, Q7TQM9, Q80TV4, Q8C7Q0, Q8CE81, Q8CIM4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: February 1, 2005
Last modified: June 2, 2021
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again