Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (26 Feb 2020)
Sequence version 2 (31 May 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein phosphatase 4 regulatory subunit 3B

Gene

PPP4R3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Alternative name(s):
SMEK homolog 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP4R3BImported
Synonyms:KIAA1387, PP4R3B, SMEK2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29267 PPP4R3B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610352 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5MIZ7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57223

Open Targets

More...
OpenTargetsi
ENSG00000275052

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162403977

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5MIZ7 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4105714

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPP4R3B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
334302843

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002546031 – 849Serine/threonine-protein phosphatase 4 regulatory subunit 3BAdd BLAST849

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei117PhosphoserineCombined sources1
Modified residuei695PhosphoserineCombined sources1
Modified residuei840PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5MIZ7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5MIZ7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5MIZ7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5MIZ7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5MIZ7

PeptideAtlas

More...
PeptideAtlasi
Q5MIZ7

PRoteomics IDEntifications database

More...
PRIDEi
Q5MIZ7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
63574 [Q5MIZ7-1]
63575 [Q5MIZ7-2]
63576 [Q5MIZ7-3]
63577 [Q5MIZ7-4]
63578 [Q5MIZ7-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5MIZ7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5MIZ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Moderately expressed in tissues and specific brain regions examined.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000275052 Expressed in oviduct epithelium and 215 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5MIZ7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB017185
HPA001233

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits.

Component of the PP4 complex PPP4C-PPP4R2-PPP4R3B.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121459, 46 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1844 PPP4C-PPP4R2-PPP4R3B protein phosphatase 4 complex

Protein interaction database and analysis system

More...
IntActi
Q5MIZ7, 23 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000483228

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5MIZ7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 100WH1Add BLAST100

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi719 – 724Poly-Glu6
Compositional biasi831 – 838Poly-Glu8

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SMEK family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2175 Eukaryota
ENOG410XQ7A LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018199

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004909_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5MIZ7

KEGG Orthology (KO)

More...
KOi
K17491

Identification of Orthologs from Complete Genome Data

More...
OMAi
DFPDTYE

Database of Orthologous Groups

More...
OrthoDBi
388216at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5MIZ7

TreeFam database of animal gene trees

More...
TreeFami
TF315190

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR006887 DUF625
IPR011993 PH-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04802 SMK-1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5MIZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDTRRRVKV YTLNEDRQWD DRGTGHVSST YVEELKGMSL LVRAESDGSL
60 70 80 90 100
LLESKINPNT AYQKQQDTLI VWSEAENYDL ALSFQEKAGC DEIWEKICQV
110 120 130 140 150
QGKDPSVEVT QDLIDESEEE RFEEMPETSH LIDLPTCELN KLEEIADLVT
160 170 180 190 200
SVLSSPIRRE KLALALENEG YIKKLLQLFQ ACENLENTEG LHHLYEIIRG
210 220 230 240 250
ILFLNKATLF EVMFSDECIM DVVGCLEYDP ALAQPKRHRE FLTKTAKFKE
260 270 280 290 300
VIPITDSELR QKIHQTYRVQ YIQDIILPTP SVFEENFLST LTSFIFFNKV
310 320 330 340 350
EIVSMLQEDE KFLSEVFAQL TDEATDDDKR RELVNFFKEF CAFSQTLQPQ
360 370 380 390 400
NRDAFFKTLA KLGILPALEI VMGMDDLQVR SAATDIFSYL VEFSPSMVRE
410 420 430 440 450
FVMQEAQQSD DDILLINVVI EQMICDTDPE LGGAVQLMGL LRTLIDPENM
460 470 480 490 500
LATTNKTEKS EFLNFFYNHC MHVLTAPLLT NTSEDKCEKD FFLKHYRYSW
510 520 530 540 550
SFICTPSHSH SHSTPSSSIS QDNIVGSNKN NTICPDNYQT AQLLALILEL
560 570 580 590 600
LTFCVEHHTY HIKNYIMNKD LLRRVLVLMN SKHTFLALCA LRFMRRIIGL
610 620 630 640 650
KDEFYNRYIT KGNLFEPVIN ALLDNGTRYN LLNSAVIELF EFIRVEDIKS
660 670 680 690 700
LTAHIVENFY KALESIEYVQ TFKGLKTKYE QEKDRQNQKL NSVPSILRSN
710 720 730 740 750
RFRRDAKALE EDEEMWFNED EEEEGKAVVA PVEKPKPEDD FPDNYEKFME
760 770 780 790 800
TKKAKESEDK ENLPKRTSPG GFKFTFSHSA SAANGTNSKS VVAQIPPATS
810 820 830 840
NGSSSKTTNL PTSVTATKGS LVGLVDYPDD EEEDEEEESS PRKRPRLGS
Length:849
Mass (Da):97,458
Last modified:May 31, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCEA2C74C0F2B3D27
GO
Isoform 2 (identifier: Q5MIZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.

Show »
Length:817
Mass (Da):93,718
Checksum:iA0D85F04FC47C546
GO
Isoform 3 (identifier: Q5MIZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-522: Missing.
     536-589: DNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALC → G

Show »
Length:764
Mass (Da):87,377
Checksum:i9EE88E92C7E6D822
GO
Isoform 4 (identifier: Q5MIZ7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-55: SLLLESK → KVIGTVE
     56-849: Missing.

Note: May be due to intron retention.Curated
Show »
Length:55
Mass (Da):6,272
Checksum:i834FDCC0E1CE827B
GO
Isoform 5 (identifier: Q5MIZ7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-566: Missing.
     693-699: Missing.

Show »
Length:276
Mass (Da):31,566
Checksum:iD21D930BC6B8ACB5
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92625 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti806K → E in BAB14430 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057734293S → T. Corresponds to variant dbSNP:rs34999684Ensembl.1
Natural variantiVAR_065187503I → V2 PublicationsCorresponds to variant dbSNP:rs2903704Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0212581 – 566Missing in isoform 5. 1 PublicationAdd BLAST566
Alternative sequenceiVSP_02125949 – 55SLLLESK → KVIGTVE in isoform 4. 1 Publication7
Alternative sequenceiVSP_02126056 – 849Missing in isoform 4. 1 PublicationAdd BLAST794
Alternative sequenceiVSP_021261491 – 522Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_021262536 – 589DNYQT…FLALC → G in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_021263693 – 699Missing in isoform 5. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY825268 mRNA Translation: AAV97750.1
AY825269 mRNA Translation: AAV97751.1
AB037808 mRNA Translation: BAA92625.1 Different initiation.
AK023148 mRNA Translation: BAB14430.1
AC015982 Genomic DNA Translation: AAY24270.1
BC006215 mRNA Translation: AAH06215.1
BC045714 mRNA Translation: AAH45714.1
BC060855 mRNA Translation: AAH60855.1
AL136556 mRNA Translation: CAB66491.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1855.1 [Q5MIZ7-3]
CCDS46289.1 [Q5MIZ7-1]
CCDS62913.1 [Q5MIZ7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001116436.2, NM_001122964.2 [Q5MIZ7-1]
NP_001269779.1, NM_001282850.1 [Q5MIZ7-2]
NP_065196.1, NM_020463.3 [Q5MIZ7-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000611717; ENSP00000478677; ENSG00000275052 [Q5MIZ7-3]
ENST00000616288; ENSP00000484116; ENSG00000275052 [Q5MIZ7-2]
ENST00000616407; ENSP00000483228; ENSG00000275052 [Q5MIZ7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57223

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57223

UCSC genome browser

More...
UCSCi
uc032nnw.2 human [Q5MIZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY825268 mRNA Translation: AAV97750.1
AY825269 mRNA Translation: AAV97751.1
AB037808 mRNA Translation: BAA92625.1 Different initiation.
AK023148 mRNA Translation: BAB14430.1
AC015982 Genomic DNA Translation: AAY24270.1
BC006215 mRNA Translation: AAH06215.1
BC045714 mRNA Translation: AAH45714.1
BC060855 mRNA Translation: AAH60855.1
AL136556 mRNA Translation: CAB66491.2
CCDSiCCDS1855.1 [Q5MIZ7-3]
CCDS46289.1 [Q5MIZ7-1]
CCDS62913.1 [Q5MIZ7-2]
RefSeqiNP_001116436.2, NM_001122964.2 [Q5MIZ7-1]
NP_001269779.1, NM_001282850.1 [Q5MIZ7-2]
NP_065196.1, NM_020463.3 [Q5MIZ7-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi121459, 46 interactors
ComplexPortaliCPX-1844 PPP4C-PPP4R2-PPP4R3B protein phosphatase 4 complex
IntActiQ5MIZ7, 23 interactors
STRINGi9606.ENSP00000483228

Chemistry databases

ChEMBLiCHEMBL4105714

PTM databases

iPTMnetiQ5MIZ7
PhosphoSitePlusiQ5MIZ7

Polymorphism and mutation databases

BioMutaiPPP4R3B
DMDMi334302843

Proteomic databases

EPDiQ5MIZ7
jPOSTiQ5MIZ7
MassIVEiQ5MIZ7
MaxQBiQ5MIZ7
PaxDbiQ5MIZ7
PeptideAtlasiQ5MIZ7
PRIDEiQ5MIZ7
ProteomicsDBi63574 [Q5MIZ7-1]
63575 [Q5MIZ7-2]
63576 [Q5MIZ7-3]
63577 [Q5MIZ7-4]
63578 [Q5MIZ7-5]

Genome annotation databases

EnsembliENST00000611717; ENSP00000478677; ENSG00000275052 [Q5MIZ7-3]
ENST00000616288; ENSP00000484116; ENSG00000275052 [Q5MIZ7-2]
ENST00000616407; ENSP00000483228; ENSG00000275052 [Q5MIZ7-1]
GeneIDi57223
KEGGihsa:57223
UCSCiuc032nnw.2 human [Q5MIZ7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57223
DisGeNETi57223

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPP4R3B
HGNCiHGNC:29267 PPP4R3B
HPAiCAB017185
HPA001233
MIMi610352 gene
neXtProtiNX_Q5MIZ7
OpenTargetsiENSG00000275052
PharmGKBiPA162403977

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2175 Eukaryota
ENOG410XQ7A LUCA
GeneTreeiENSGT00390000018199
HOGENOMiCLU_004909_3_0_1
InParanoidiQ5MIZ7
KOiK17491
OMAiDFPDTYE
OrthoDBi388216at2759
PhylomeDBiQ5MIZ7
TreeFamiTF315190

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPP4R3B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SMEK2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57223
PharosiQ5MIZ7 Tbio

Protein Ontology

More...
PROi
PR:Q5MIZ7
RNActiQ5MIZ7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000275052 Expressed in oviduct epithelium and 215 other tissues
GenevisibleiQ5MIZ7 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR006887 DUF625
IPR011993 PH-like_dom_sf
PfamiView protein in Pfam
PF04802 SMK-1, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP4R3B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5MIZ7
Secondary accession number(s): Q6P9B0
, Q86XB8, Q9BQJ0, Q9BRK2, Q9H913, Q9P2G0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: May 31, 2011
Last modified: February 26, 2020
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again