Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 83 (16 Oct 2019)
Sequence version 2 (15 Jun 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protein 232

Gene

Tmem232

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 232
Alternative name(s):
Testis-specific protein 13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tmem232
Synonyms:Tes13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2685786 Tmem232

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei163 – 183HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003950361 – 675Transmembrane protein 232Add BLAST675

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5K6N0

PRoteomics IDEntifications database

More...
PRIDEi
Q5K6N0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5K6N0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5K6N0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000045036 Expressed in 59 organ(s), highest expression level in dorsal pancreas

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5K6N0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5K6N0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000055652

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili598 – 634Sequence analysisAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi61 – 64Poly-Glu4

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IG5N Eukaryota
ENOG4111R3E LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014003

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000054199

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5K6N0

Identification of Orthologs from Complete Genome Data

More...
OMAi
QEVMKKR

Database of Orthologous Groups

More...
OrthoDBi
679293at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5K6N0

TreeFam database of animal gene trees

More...
TreeFami
TF336968

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031747 TMEM232

The PANTHER Classification System

More...
PANTHERi
PTHR28651 PTHR28651, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15877 TMEM232, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5K6N0-1) [UniParc]FASTAAdd to basket
Also known as: Tes13-L

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAYKPPVVN KFGVISSTYH EELLKSIFES SNRRKSQKPK PSFSISKEFI
60 70 80 90 100
LRFNHTDNPA EEEELLEQAR RLIVRSKRKL GLKTLGSGKH VHLPTAWAEV
110 120 130 140 150
IYLAQCKGEI QDEALNMLHA SLDHVSFDHD QLPALFFLAE SVLYRLCCDA
160 170 180 190 200
FMKGYLYSVE IKLVKIGYLI FLRLFVFFLH GHLESFKQHL LRLQPYLYAL
210 220 230 240 250
HFSEPSYYKY PNIISNVQFI LKTSEIICKR ELHSEPFVES PDETEDPYSD
260 270 280 290 300
LNHLQLNKRG YEVNHLLWHS VAAWSCVQNN RPQLTEVLEH LLFYKTQLQT
310 320 330 340 350
KCWLDSALAL MVLGEAAKLD MACLKTLMDL VTDFLENILS AQNQEENYNI
360 370 380 390 400
YDTSWASEIV FTYTTIIAEV CLYAATSDLR KTALIGFCAC KSPQQGISLT
410 420 430 440 450
DKSEELPELD GASILTLLKY FSSRISDNCE KVIWIGYYGI VYNLVKMSWE
460 470 480 490 500
LQGEQDQDGL RNMIWQTLQK IKDYEQDPRI RCALVIAQAE LNGPSDPFCT
510 520 530 540 550
KATPNSGEEV FSKYIGWRIA TTLSRLFFPS LDVAPPKTPV EVDLPRKHTI
560 570 580 590 600
RERQPAKKRV LRFILKDHSS VVEVSMTPYP NFFTKADKKL EEIIDHHWQK
610 620 630 640 650
DMEARKREEE AYKAQNQKDK EEKEKIHFQE IMKQRERKLN KQTKPYEIIL
660 670
SEKESGSEKK CGFFELKPST APNAK
Length:675
Mass (Da):78,275
Last modified:June 15, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3E815C48A2934F33
GO
Isoform 2 (identifier: Q5K6N0-2) [UniParc]FASTAAdd to basket
Also known as: Tes13-S

The sequence of this isoform differs from the canonical sequence as follows:
     2-40: KAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQKPK → TSKKW

Show »
Length:641
Mass (Da):74,402
Checksum:iDACFC7380030A377
GO
Isoform 3 (identifier: Q5K6N0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-113: Missing.

Note: No experimental confirmation available.
Show »
Length:674
Mass (Da):78,146
Checksum:i06DCA0F61AB9322E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B2W4C3A0A3B2W4C3_MOUSE
Transmembrane protein 232
Tmem232
559Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti3A → V in AAQ14895 (Ref. 1) Curated1
Sequence conflicti95T → P in AAQ14894 (Ref. 1) Curated1
Sequence conflicti95T → P in AAQ14895 (Ref. 1) Curated1
Sequence conflicti463M → K in AAQ14894 (Ref. 1) Curated1
Sequence conflicti463M → K in AAQ14895 (Ref. 1) Curated1
Sequence conflicti481R → Q in AAQ14894 (Ref. 1) Curated1
Sequence conflicti481R → Q in AAQ14895 (Ref. 1) Curated1
Sequence conflicti501K → E in AAQ14894 (Ref. 1) Curated1
Sequence conflicti501K → E in AAQ14895 (Ref. 1) Curated1
Sequence conflicti542V → M in AAQ14894 (Ref. 1) Curated1
Sequence conflicti542V → M in AAQ14895 (Ref. 1) Curated1
Sequence conflicti556A → S in AAQ14894 (Ref. 1) Curated1
Sequence conflicti556A → S in AAQ14895 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0393532 – 40KAYKP…SQKPK → TSKKW in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_039354113Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF338468 mRNA Translation: AAQ14894.1
AF338469 mRNA Translation: AAQ14895.1
BC150885 mRNA Translation: AAI50886.1
BC172032 mRNA Translation: AAI72032.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28940.1 [Q5K6N0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001008973.2, NM_001008973.2 [Q5K6N0-1]
NP_001276414.1, NM_001289485.1 [Q5K6N0-1]
NP_001276415.1, NM_001289486.1 [Q5K6N0-3]
XP_006524554.1, XM_006524491.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000062161; ENSMUSP00000055652; ENSMUSG00000045036 [Q5K6N0-1]
ENSMUST00000086722; ENSMUSP00000083927; ENSMUSG00000045036 [Q5K6N0-1]
ENSMUST00000233117; ENSMUSP00000156833; ENSMUSG00000045036 [Q5K6N0-3]
ENSMUST00000233738; ENSMUSP00000156513; ENSMUSG00000045036 [Q5K6N0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
381107

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:381107

UCSC genome browser

More...
UCSCi
uc008dga.1 mouse [Q5K6N0-1]
uc012awg.1 mouse [Q5K6N0-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF338468 mRNA Translation: AAQ14894.1
AF338469 mRNA Translation: AAQ14895.1
BC150885 mRNA Translation: AAI50886.1
BC172032 mRNA Translation: AAI72032.1
CCDSiCCDS28940.1 [Q5K6N0-1]
RefSeqiNP_001008973.2, NM_001008973.2 [Q5K6N0-1]
NP_001276414.1, NM_001289485.1 [Q5K6N0-1]
NP_001276415.1, NM_001289486.1 [Q5K6N0-3]
XP_006524554.1, XM_006524491.3

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000055652

PTM databases

iPTMnetiQ5K6N0
PhosphoSitePlusiQ5K6N0

Proteomic databases

PaxDbiQ5K6N0
PRIDEiQ5K6N0

Genome annotation databases

EnsembliENSMUST00000062161; ENSMUSP00000055652; ENSMUSG00000045036 [Q5K6N0-1]
ENSMUST00000086722; ENSMUSP00000083927; ENSMUSG00000045036 [Q5K6N0-1]
ENSMUST00000233117; ENSMUSP00000156833; ENSMUSG00000045036 [Q5K6N0-3]
ENSMUST00000233738; ENSMUSP00000156513; ENSMUSG00000045036 [Q5K6N0-2]
GeneIDi381107
KEGGimmu:381107
UCSCiuc008dga.1 mouse [Q5K6N0-1]
uc012awg.1 mouse [Q5K6N0-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
642987
MGIiMGI:2685786 Tmem232

Phylogenomic databases

eggNOGiENOG410IG5N Eukaryota
ENOG4111R3E LUCA
GeneTreeiENSGT00390000014003
HOGENOMiHOG000054199
InParanoidiQ5K6N0
OMAiQEVMKKR
OrthoDBi679293at2759
PhylomeDBiQ5K6N0
TreeFamiTF336968

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Tmem232 mouse

Protein Ontology

More...
PROi
PR:Q5K6N0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000045036 Expressed in 59 organ(s), highest expression level in dorsal pancreas
ExpressionAtlasiQ5K6N0 baseline and differential
GenevisibleiQ5K6N0 MM

Family and domain databases

InterProiView protein in InterPro
IPR031747 TMEM232
PANTHERiPTHR28651 PTHR28651, 1 hit
PfamiView protein in Pfam
PF15877 TMEM232, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM232_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5K6N0
Secondary accession number(s): B2RX35, B7ZWG2, Q5K6N1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 15, 2010
Last sequence update: June 15, 2010
Last modified: October 16, 2019
This is version 83 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again