Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5JVF3 (PCID2_HUMAN)

Entry version 150 (10 Feb 2021)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Add a publicationFeedback
Protein

PCI domain-containing protein 2

Gene

PCID2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation (By similarity). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:22307388) (Probable). Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and transcription-associated genomic instability. R-loop accumulation does not increase in PCID2-depleted cells (PubMed:24896180).By similarity1 Publication2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5JVF3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PCI domain-containing protein 2
Alternative name(s):
CSN12-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCID2
ORF Names:HT004
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25653, PCID2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613713, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5JVF3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000126226.21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55795

Open Targets

More...OpenTargetsi		ENSG00000126226

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA144596397

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5JVF3, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PCID2

Domain mapping of disease mutations (DMDM)

More...DMDMi		85681034

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001210292 – 399PCI domain-containing protein 2Add BLAST398

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanine1 Publication1
Modified residuei45PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5JVF3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5JVF3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5JVF3

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5JVF3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5JVF3

PeptideAtlas

More...PeptideAtlasi		Q5JVF3

PRoteomics IDEntifications database

More...PRIDEi		Q5JVF3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		63327 [Q5JVF3-1]
63328 [Q5JVF3-2]
63329 [Q5JVF3-3]
63330 [Q5JVF3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5JVF3

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q5JVF3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5JVF3

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q5JVF3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000126226, Expressed in oocyte and 232 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5JVF3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5JVF3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000126226, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the nuclear pore complex (NPC)-associated TREX-2 complex (transcription and export complex 2), composed of at least GANP, 2 copies of ENY2, PCID2, SEM1/DSS1, and either centrin CETN2 or centrin CETN3. The TREX-2 complex also associates with ALYREF/ALY and with the nucleoporin NUP153 (PubMed:22307388, PubMed:23591820).

Interacts with BRCA2 (PubMed:24896180).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120908, 47 interactors

Database of interacting proteins

More...DIPi		DIP-50497N

Protein interaction database and analysis system

More...IntActi		Q5JVF3, 24 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5JVF3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1399
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5JVF3

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini210 – 391PCIPROSITE-ProRule annotationAdd BLAST182

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CSN12 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00390000001101

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_031567_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5JVF3

Identification of Orthologs from Complete Genome Data

More...OMAi		TYLIPCH

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5JVF3

TreeFam database of animal gene trees

More...TreeFami		TF106136

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000717, PCI_dom
IPR036388, WH-like_DNA-bd_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01399, PCI, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50250, PCI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5JVF3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAHITINQYL QQVYEAIDSR DGASCAELVS FKHPHVANPR LQMASPEEKC 
        60         70         80         90        100
QQVLEPPYDE MFAAHLRCTY AVGNHDFIEA YKCQTVIVQS FLRAFQAHKE 
       110        120        130        140        150
ENWALPVMYA VALDLRVFAN NADQQLVKKG KSKVGDMLEK AAELLMSCFR 
       160        170        180        190        200
VCASDTRAGI EDSKKWGMLF LVNQLFKIYF KINKLHLCKP LIRAIDSSNL 
       210        220        230        240        250
KDDYSTAQRV TYKYYVGRKA MFDSDFKQAE EYLSFAFEHC HRSSQKNKRM 
       260        270        280        290        300
ILIYLLPVKM LLGHMPTVEL LKKYHLMQFA EVTRAVSEGN LLLLHEALAK 
       310        320        330        340        350
HEAFFIRCGI FLILEKLKII TYRNLFKKVY LLLKTHQLSL DAFLVALKFM 
       360        370        380        390 
QVEDVDIDEV QCILANLIYM GHVKGYISHQ HQKLVVSKQN PFPPLSTVC
Length:399
Mass (Da):46,030
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8D23273361F00E18
GO
Isoform 2 (identifier: Q5JVF3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MAHITINQYLQQ → MRLTDVVQQL

Show »
Length:397
Mass (Da):45,773
Checksum:i785FD46B5D72AF70
GO
Isoform 3 (identifier: Q5JVF3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-114: Missing.

Show »
Length:376
Mass (Da):43,375
Checksum:i039E8F8B8192F3C1
GO
Isoform 4 (identifier: Q5JVF3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-89: Q → QYPLSFMAAVPHRTHAVDYLGLETRKHWASCSFLQLERNDSVLEQKLVSALSLGT

Show »
Length:453
Mass (Da):52,100
Checksum:i57BB6C3A1E85A059
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG09695 differs from that shown. Reason: Frameshift.Curated
The sequence BAB15768 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74N → D in AAH31246 (PubMed:15489334).Curated1
Sequence conflicti87I → L in BAA91407 (PubMed:14702039).Curated1
Sequence conflicti106P → L in AAG09695 (Ref. 2) Curated1
Sequence conflicti129K → E in AAG09695 (Ref. 2) Curated1
Sequence conflicti145L → M in BAA91407 (PubMed:14702039).Curated1
Sequence conflicti180F → I in BAA91611 (PubMed:14702039).Curated1
Sequence conflicti313I → T in BAA92118 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0168431 – 12MAHIT…QYLQQ → MRLTDVVQQL in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_01684489Q → QYPLSFMAAVPHRTHAVDYL GLETRKHWASCSFLQLERND SVLEQKLVSALSLGT in isoform 4. 1 Publication1
Alternative sequenceiVSP_01684592 – 114Missing in isoform 3. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK000888 mRNA Translation: BAA91407.1
AK001185 mRNA Translation: BAA91542.1
AK001302 mRNA Translation: BAA91611.1
AK002167 mRNA Translation: BAA92118.1
AK023313 mRNA Translation: BAB14521.1
AK024478 mRNA Translation: BAB15768.1 Different initiation.
AF183426 mRNA Translation: AAG09695.1 Frameshift.
AL136221 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC016614 mRNA Translation: AAH16614.1
BC031246 mRNA Translation: AAH31246.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS58301.1 [Q5JVF3-2]
CCDS58302.1 [Q5JVF3-4]
CCDS9532.2 [Q5JVF3-1]

NCBI Reference Sequences

More...RefSeqi		NP_001120674.1, NM_001127202.3 [Q5JVF3-1]
NP_001120675.1, NM_001127203.3 [Q5JVF3-1]
NP_001245142.1, NM_001258213.2 [Q5JVF3-2]
NP_001307584.1, NM_001320655.1 [Q5JVF3-2]
NP_001307585.1, NM_001320656.1 [Q5JVF3-4]
NP_001307586.1, NM_001320657.1
NP_001307589.1, NM_001320660.1
NP_060856.2, NM_018386.4 [Q5JVF3-1]
XP_016876153.1, XM_017020664.1 [Q5JVF3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000246505; ENSP00000246505; ENSG00000126226 [Q5JVF3-4]
ENST00000337344; ENSP00000337405; ENSG00000126226 [Q5JVF3-1]
ENST00000375457; ENSP00000364606; ENSG00000126226 [Q5JVF3-2]
ENST00000375459; ENSP00000364608; ENSG00000126226 [Q5JVF3-2]
ENST00000375477; ENSP00000364626; ENSG00000126226 [Q5JVF3-1]
ENST00000375479; ENSP00000364628; ENSG00000126226 [Q5JVF3-1]
ENST00000622406; ENSP00000479494; ENSG00000126226 [Q5JVF3-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55795

UCSC genome browser

More...UCSCi		uc058ylr.1, human [Q5JVF3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000888 mRNA Translation: BAA91407.1
AK001185 mRNA Translation: BAA91542.1
AK001302 mRNA Translation: BAA91611.1
AK002167 mRNA Translation: BAA92118.1
AK023313 mRNA Translation: BAB14521.1
AK024478 mRNA Translation: BAB15768.1 Different initiation.
AF183426 mRNA Translation: AAG09695.1 Frameshift.
AL136221 Genomic DNA No translation available.
AL137002 Genomic DNA No translation available.
BC016614 mRNA Translation: AAH16614.1
BC031246 mRNA Translation: AAH31246.1
CCDSiCCDS58301.1 [Q5JVF3-2]
CCDS58302.1 [Q5JVF3-4]
CCDS9532.2 [Q5JVF3-1]
RefSeqiNP_001120674.1, NM_001127202.3 [Q5JVF3-1]
NP_001120675.1, NM_001127203.3 [Q5JVF3-1]
NP_001245142.1, NM_001258213.2 [Q5JVF3-2]
NP_001307584.1, NM_001320655.1 [Q5JVF3-2]
NP_001307585.1, NM_001320656.1 [Q5JVF3-4]
NP_001307586.1, NM_001320657.1
NP_001307589.1, NM_001320660.1
NP_060856.2, NM_018386.4 [Q5JVF3-1]
XP_016876153.1, XM_017020664.1 [Q5JVF3-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3T5XX-ray2.12A201-399[»]
SMRiQ5JVF3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi120908, 47 interactors
DIPiDIP-50497N
IntActiQ5JVF3, 24 interactors

PTM databases

iPTMnetiQ5JVF3
MetOSiteiQ5JVF3
PhosphoSitePlusiQ5JVF3
SwissPalmiQ5JVF3

Genetic variation databases

BioMutaiPCID2
DMDMi85681034

Proteomic databases

EPDiQ5JVF3
jPOSTiQ5JVF3
MassIVEiQ5JVF3
MaxQBiQ5JVF3
PaxDbiQ5JVF3
PeptideAtlasiQ5JVF3
PRIDEiQ5JVF3
ProteomicsDBi63327 [Q5JVF3-1]
63328 [Q5JVF3-2]
63329 [Q5JVF3-3]
63330 [Q5JVF3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25858, 88 antibodies

The DNASU plasmid repository

More...DNASUi		55795

Genome annotation databases

EnsembliENST00000246505; ENSP00000246505; ENSG00000126226 [Q5JVF3-4]
ENST00000337344; ENSP00000337405; ENSG00000126226 [Q5JVF3-1]
ENST00000375457; ENSP00000364606; ENSG00000126226 [Q5JVF3-2]
ENST00000375459; ENSP00000364608; ENSG00000126226 [Q5JVF3-2]
ENST00000375477; ENSP00000364626; ENSG00000126226 [Q5JVF3-1]
ENST00000375479; ENSP00000364628; ENSG00000126226 [Q5JVF3-1]
ENST00000622406; ENSP00000479494; ENSG00000126226 [Q5JVF3-4]
GeneIDi55795
KEGGihsa:55795
UCSCiuc058ylr.1, human [Q5JVF3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55795
DisGeNETi55795

GeneCards: human genes, protein and diseases

More...GeneCardsi		PCID2
HGNCiHGNC:25653, PCID2
HPAiENSG00000126226, Low tissue specificity
MIMi613713, gene
neXtProtiNX_Q5JVF3
OpenTargetsiENSG00000126226
PharmGKBiPA144596397
VEuPathDBiHostDB:ENSG00000126226.21

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00390000001101
HOGENOMiCLU_031567_2_0_1
InParanoidiQ5JVF3
OMAiTYLIPCH
PhylomeDBiQ5JVF3
TreeFamiTF106136

Enzyme and pathway databases

PathwayCommonsiQ5JVF3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55795, 715 hits in 878 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PCID2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55795
PharosiQ5JVF3, Tdark

Protein Ontology

More...PROi		PR:Q5JVF3
RNActiQ5JVF3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000126226, Expressed in oocyte and 232 other tissues
ExpressionAtlasiQ5JVF3, baseline and differential
GenevisibleiQ5JVF3, HS

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000717, PCI_dom
IPR036388, WH-like_DNA-bd_sf
PfamiView protein in Pfam
PF01399, PCI, 1 hit
PROSITEiView protein in PROSITE
PS50250, PCI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCID2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5JVF3
Secondary accession number(s): A6NK09
, Q3ZCX1, Q5TC57, Q5TC58, Q9H7K1, Q9HBZ7, Q9NUK6, Q9NVY1, Q9NW44, Q9NWH3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: February 10, 2021
This is version 150 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again