Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5JS54 (PSMG4_HUMAN)

Entry version 99 (17 Jun 2020)
Sequence version 2 (10 Jun 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Proteasome assembly chaperone 4

Gene

PSMG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Chaperone protein which promotes assembly of the 20S proteasome.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proteasome assembly chaperone 4
Short name:
PAC-4
Short name:
hPAC4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PSMG4
Synonyms:C6orf86, PAC4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000180822.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:21108 PSMG4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		617550 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5JS54

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		389362

Open Targets

More...OpenTargetsi		ENSG00000180822

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162400256

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5JS54 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PSMG4

Domain mapping of disease mutations (DMDM)

More...DMDMi		190360085

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003413971 – 123Proteasome assembly chaperone 4Add BLAST123

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5JS54

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5JS54

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5JS54

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5JS54

PeptideAtlas

More...PeptideAtlasi		Q5JS54

PRoteomics IDEntifications database

More...PRIDEi		Q5JS54

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		30974
63135 [Q5JS54-1]
8201

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q5JS54-1 [Q5JS54-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5JS54

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000180822 Expressed in quadriceps femoris and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5JS54 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5JS54 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000180822 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PSMG3. Associates with alpha subunits of the 20S proteasome (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		133110, 38 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q5JS54

Protein interaction database and analysis system

More...IntActi		Q5JS54, 16 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5JS54 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1123
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5JS54

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PSMG4 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00390000011804

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_138031_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5JS54

KEGG Orthology (KO)

More...KOi		K11878

Identification of Orthologs from Complete Genome Data

More...OMAi		FHVMKLS

Database of Orthologous Groups

More...OrthoDBi		1468993at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5JS54

TreeFam database of animal gene trees

More...TreeFami		TF353302

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR032157 PAC4

The PANTHER Classification System

More...PANTHERi		PTHR33559 PTHR33559, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16093 PAC4, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5JS54-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGLVVAAGG DVSLHNFSAR LWEQLVHFHV MRLTDSLFLW VGATPHLRNL 
        60         70         80         90        100
AVAMCSRYDS IPVSTSLLGD TSDTTSTGLA QRLARKTNKQ VFVSYNLQNT 
       110        120 
DSNFALLVEN RIKEEMEAFP EKF
Length:123
Mass (Da):13,775
Last modified:June 10, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i44F98C0CC00B937F
GO
Isoform 2 (identifier: Q5JS54-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: L → LGLGGKTGLACECGVEWGLSKGHEAECSTLPTPQHTSCGP

Show »
Length:162
Mass (Da):17,656
Checksum:i74DDE9E665AD0E2C
GO
Isoform 3 (identifier: Q5JS54-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-123: ARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF → GMYPQLALHGQPGGAHSLMEP

Show »
Length:104
Mass (Da):11,216
Checksum:i1CFBFF2D577224DE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C465H7C465_HUMAN
Proteasome assembly chaperone 4
PSMG4
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB92D6RB92_HUMAN
Proteasome assembly chaperone 4
PSMG4
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REN3D6REN3_HUMAN
Proteasome assembly chaperone 4
PSMG4
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E2QRC7E2QRC7_HUMAN
Proteasome assembly chaperone 4
PSMG4
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3E0F2Z3E0_HUMAN
Proteasome assembly chaperone 4
PSMG4
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R926D6R926_HUMAN
Proteasome assembly chaperone 4
PSMG4
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47L → Q in CD173424 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04663583L → LGLGGKTGLACECGVEWGLS KGHEAECSTLPTPQHTSCGP in isoform 2. Curated1
Alternative sequenceiVSP_04663684 – 123ARKTN…FPEKF → GMYPQLALHGQPGGAHSLME P in isoform 3. CuratedAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL445309 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55130.1
CD173424 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47360.1 [Q5JS54-2]
CCDS47361.1 [Q5JS54-1]
CCDS47362.1 [Q5JS54-3]

NCBI Reference Sequences

More...RefSeqi		NP_001122063.1, NM_001128591.1 [Q5JS54-1]
NP_001122064.1, NM_001128592.1 [Q5JS54-2]
NP_001129222.1, NM_001135750.1 [Q5JS54-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000419065; ENSP00000392353; ENSG00000180822 [Q5JS54-2]
ENST00000438998; ENSP00000413353; ENSG00000180822 [Q5JS54-1]
ENST00000473000; ENSP00000418241; ENSG00000180822 [Q5JS54-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		389362

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:389362

UCSC genome browser

More...UCSCi		uc003mvl.2 human [Q5JS54-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL445309 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55130.1
CD173424 mRNA No translation available.
CCDSiCCDS47360.1 [Q5JS54-2]
CCDS47361.1 [Q5JS54-1]
CCDS47362.1 [Q5JS54-3]
RefSeqiNP_001122063.1, NM_001128591.1 [Q5JS54-1]
NP_001122064.1, NM_001128592.1 [Q5JS54-2]
NP_001129222.1, NM_001135750.1 [Q5JS54-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WTQX-ray1.90A/B/C/D1-123[»]
SMRiQ5JS54
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi133110, 38 interactors
CORUMiQ5JS54
IntActiQ5JS54, 16 interactors

PTM databases

iPTMnetiQ5JS54

Polymorphism and mutation databases

BioMutaiPSMG4
DMDMi190360085

Proteomic databases

EPDiQ5JS54
jPOSTiQ5JS54
MassIVEiQ5JS54
MaxQBiQ5JS54
PeptideAtlasiQ5JS54
PRIDEiQ5JS54
ProteomicsDBi30974
63135 [Q5JS54-1]
8201
TopDownProteomicsiQ5JS54-1 [Q5JS54-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		78115 4 antibodies

Genome annotation databases

EnsembliENST00000419065; ENSP00000392353; ENSG00000180822 [Q5JS54-2]
ENST00000438998; ENSP00000413353; ENSG00000180822 [Q5JS54-1]
ENST00000473000; ENSP00000418241; ENSG00000180822 [Q5JS54-3]
GeneIDi389362
KEGGihsa:389362
UCSCiuc003mvl.2 human [Q5JS54-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		389362
DisGeNETi389362
EuPathDBiHostDB:ENSG00000180822.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		PSMG4
HGNCiHGNC:21108 PSMG4
HPAiENSG00000180822 Low tissue specificity
MIMi617550 gene
neXtProtiNX_Q5JS54
OpenTargetsiENSG00000180822
PharmGKBiPA162400256

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00390000011804
HOGENOMiCLU_138031_0_0_1
InParanoidiQ5JS54
KOiK11878
OMAiFHVMKLS
OrthoDBi1468993at2759
PhylomeDBiQ5JS54
TreeFamiTF353302

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		389362 671 hits in 787 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PSMG4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		389362
PharosiQ5JS54 Tdark

Protein Ontology

More...PROi		PR:Q5JS54
RNActiQ5JS54 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000180822 Expressed in quadriceps femoris and 212 other tissues
ExpressionAtlasiQ5JS54 baseline and differential
GenevisibleiQ5JS54 HS

Family and domain databases

InterProiView protein in InterPro
IPR032157 PAC4
PANTHERiPTHR33559 PTHR33559, 1 hit
PfamiView protein in Pfam
PF16093 PAC4, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPSMG4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5JS54
Secondary accession number(s): C9J2F8
, F8WBZ2, Q5JS53, Q5JS56
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: June 17, 2020
This is version 99 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again