Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - Q5JS13 (RGPS1_HUMAN)

Entry version 125 (25 May 2022)
Sequence version 1 (05 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Ras-specific guanine nucleotide-releasing factor RalGPS1

Gene

RALGPS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity).

Guanine nucleotide exchange factor for.

By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: FlyBase
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5JS13

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q5JS13

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q5JS13

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-specific guanine nucleotide-releasing factor RalGPS1
Alternative name(s):
Ral GEF with PH domain and SH3-binding motif 1
Ral guanine nucleotide exchange factor 2
Short name:
RalGEF 2
RalA exchange factor RalGPS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RALGPS1
Synonyms:KIAA0351, RALGEF2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16851, RALGPS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614444, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5JS13

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000136828

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi148L → A: Loss of activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9649

Open Targets

More...OpenTargetsi		ENSG00000136828

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134907502

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5JS13, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RALGPS1

Domain mapping of disease mutations (DMDM)

More...DMDMi		189040074

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003331921 – 557Ras-specific guanine nucleotide-releasing factor RalGPS1Add BLAST557

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5JS13

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5JS13

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5JS13

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5JS13

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5JS13

PeptideAtlas

More...PeptideAtlasi		Q5JS13

PRoteomics IDEntifications database

More...PRIDEi		Q5JS13

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19273
63124 [Q5JS13-1]
63125 [Q5JS13-2]
63126 [Q5JS13-3]
63127 [Q5JS13-4]
63128 [Q5JS13-5]
63129 [Q5JS13-6]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q5JS13, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5JS13

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5JS13

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000136828, Expressed in cortical plate and 215 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5JS13, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5JS13, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000136828, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the SH3 domains of GRB2, NCK1, PLCG1 and SRC.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115007, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q5JS13, 3 interactors

Molecular INTeraction database

More...MINTi		Q5JS13

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000259351

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5JS13, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1557
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q5JS13

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5JS13

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 289Ras-GEFPROSITE-ProRule annotationAdd BLAST240
Domaini431 – 543PHPROSITE-ProRule annotationAdd BLAST113

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni289 – 342DisorderedSequence analysisAdd BLAST54
Regioni372 – 412DisorderedSequence analysisAdd BLAST41
Regioni433 – 557Required for stimulation of nucleotide exchange by RALAAdd BLAST125

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi330 – 333PXXP4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi312 – 326Polar residuesSequence analysisAdd BLAST15
Compositional biasi382 – 412Polar residuesSequence analysisAdd BLAST31

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain mediates binding to membranes. It is required for efficient GEF activity.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3417, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154079

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021333_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5JS13

Identification of Orthologs from Complete Genome Data

More...OMAi		GPCICAL

Database of Orthologous Groups

More...OrthoDBi		343666at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5JS13

TreeFam database of animal gene trees

More...TreeFami		TF352150

Family and domain databases

Conserved Domains Database

More...CDDi		cd00155, RasGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.840.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008937, Ras-like_GEF
IPR023578, Ras_GEF_dom_sf
IPR001895, RASGEF_cat_dom
IPR036964, RASGEF_cat_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR23113, PTHR23113, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00169, PH, 1 hit
PF00617, RasGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00233, PH, 1 hit
SM00147, RasGEF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48366, SSF48366, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50009, RASGEF_CAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5JS13-1) [UniParc]FASTAAdd to basket
Also known as: RALGPS1B

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYKRNGLMAS VLVTSATPQG SSSSDSLEGQ SCDYASKSYD AVVFDVLKVT 
        60         70         80         90        100
PEEFASQITL MDIPVFKAIQ PEELASCGWS KKEKHSLAPN VVAFTRRFNQ 
       110        120        130        140        150
VSFWVVREIL TAQTLKIRAE ILSHFVKIAK KLLELNNLHS LMSVVSALQS 
       160        170        180        190        200
APIFRLTKTW ALLNRKDKTT FEKLDYLMSK EDNYKRTREY IRSLKMVPSI 
       210        220        230        240        250
PYLGIYLLDL IYIDSAYPAS GSIMENEQRS NQMNNILRII ADLQVSCSYD 
       260        270        280        290        300
HLTTLPHVQK YLKSVRYIEE LQKFVEDDNY KLSLRIEPGS SSPRLVSSKE 
       310        320        330        340        350
DLAGPSAGSG SARFSRRPTC PDTSVAGSLP TPPVPRHRKS HSLGNNMMCQ 
       360        370        380        390        400
LSVVESKSAT FPSEKARHLL DDSVLESRSP RRGLALTSSS AVTNGLSLGS 
       410        420        430        440        450
SESSEFSEEM SSGLESPTGP CICSLGNSAA VPTMEGPLRR KTLLKEGRKP 
       460        470        480        490        500
ALSSWTRYWV ILSGSTLLYY GAKSLRGTDR KHYKSTPGKK VSIVGWMVQL 
       510        520        530        540        550
PDDPEHPDIF QLNNPDKGNV YKFQTGSRFH AILWHKHLDD ACKSNRPQVP 

ANLMSFE
Length:557
Mass (Da):62,133
Last modified:February 5, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0C93A55468ED95ED
GO
Isoform 2 (identifier: Q5JS13-2) [UniParc]FASTAAdd to basket
Also known as: RALGPS1A

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     483-490: Missing.
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Show »
Length:529
Mass (Da):58,975
Checksum:i49CFB803DABF6BAA
GO
Isoform 3 (identifier: Q5JS13-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-384: GPSAGSGSAR...LESRSPRRGL → VSHLSSLSHQ...TLGSRSRRIT
     385-557: Missing.

Show »
Length:384
Mass (Da):43,154
Checksum:i2B0F6988D850036E
GO
Isoform 4 (identifier: Q5JS13-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-305: GP → AM
     306-557: Missing.

Show »
Length:305
Mass (Da):34,728
Checksum:iA23253E8A5E97706
GO
Isoform 5 (identifier: Q5JS13-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-213: IYLLDLIYI → RSLNWLIFF
     214-557: Missing.

Show »
Length:213
Mass (Da):24,325
Checksum:i6BE4541C45159E89
GO
Isoform 6 (identifier: Q5JS13-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-108: ELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVRE → KGWPARMEDSLQKSTVSSRPHDTLQFRKTLPVGPGT
     109-557: Missing.

Show »
Length:108
Mass (Da):11,772
Checksum:i96CA60064D585BB5
GO
Isoform 7 (identifier: Q5JS13-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-415: MMCQLSVVES...FSEEMSSGLE → RGRLYATLGPNWRVPVRNSPRTRSCVY
     549-557: VPANLMSFE → EAGAAPGPTGTDSHEVDHLEGGAGKEAGPCA

Show »
Length:537
Mass (Da):59,865
Checksum:i3CCD9778267F43FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JT61Q5JT61_HUMAN
Ras-specific guanine nucleotide-rel...
RALGPS1
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6A2H0Y6A2_HUMAN
Ras-specific guanine nucleotide-rel...
RALGPS1
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH19329 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAA20808 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti86S → T in AAH32372 (PubMed:15489334).Curated1
Sequence conflicti189E → G in BAG61198 (PubMed:14702039).Curated1
Sequence conflicti251H → R in BAG61198 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061785290S → N. Corresponds to variant dbSNP:rs55918931Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03347173 – 108ELASC…WVVRE → KGWPARMEDSLQKSTVSSRP HDTLQFRKTLPVGPGT in isoform 6. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033472109 – 557Missing in isoform 6. 1 PublicationAdd BLAST449
Alternative sequenceiVSP_033473205 – 213IYLLDLIYI → RSLNWLIFF in isoform 5. Curated9
Alternative sequenceiVSP_033474214 – 557Missing in isoform 5. CuratedAdd BLAST344
Alternative sequenceiVSP_033475304 – 384GPSAG…PRRGL → VSHLSSLSHQGQAEEARLKP TSGQHPAWMWPSSSRVPAAP PASAAPRSPWPRNLRNDQGQ PGAVALTCNPSTLGSRSRRI T in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_033476304 – 305GP → AM in isoform 4. 1 Publication2
Alternative sequenceiVSP_033477306 – 557Missing in isoform 4. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_033478347 – 415MMCQL…SSGLE → RGRLYATLGPNWRVPVRNSP RTRSCVY in isoform 2 and isoform 7. 2 PublicationsAdd BLAST69
Alternative sequenceiVSP_033479385 – 557Missing in isoform 3. 1 PublicationAdd BLAST173
Alternative sequenceiVSP_033480483 – 490Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_033481549 – 557VPANLMSFE → EAGAAPGPTGTDSHEVDHLE GGAGKEAGPCA in isoform 2 and isoform 7. 2 Publications9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF221098 mRNA Translation: AAF65253.1
AB002349 mRNA Translation: BAA20808.2 Different initiation.
AK299149 mRNA Translation: BAG61198.1
AL160169 Genomic DNA No translation available.
AL356862 Genomic DNA No translation available.
AL357623 Genomic DNA No translation available.
AL450263 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87645.1
CH471090 Genomic DNA Translation: EAW87646.1
CH471090 Genomic DNA Translation: EAW87648.1
BC019329 mRNA Translation: AAH19329.1 Different initiation.
BC032372 mRNA Translation: AAH32372.1
BC033708 mRNA Translation: AAH33708.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS35143.1 [Q5JS13-1]
CCDS55344.1 [Q5JS13-4]
CCDS55345.1 [Q5JS13-7]
CCDS55346.1 [Q5JS13-2]

NCBI Reference Sequences

More...RefSeqi		NP_001177657.1, NM_001190728.1 [Q5JS13-2]
NP_001177658.1, NM_001190729.1 [Q5JS13-7]
NP_001177659.1, NM_001190730.1 [Q5JS13-4]
NP_001309249.1, NM_001322320.1 [Q5JS13-7]
NP_055451.1, NM_014636.2 [Q5JS13-1]
XP_016870836.1, XM_017015347.1
XP_016870839.1, XM_017015350.1 [Q5JS13-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000259351.10; ENSP00000259351.5; ENSG00000136828.19
ENST00000373434.5; ENSP00000362533.1; ENSG00000136828.19 [Q5JS13-2]
ENST00000373436.5; ENSP00000362535.1; ENSG00000136828.19 [Q5JS13-4]
ENST00000394011.7; ENSP00000377579.3; ENSG00000136828.19 [Q5JS13-6]
ENST00000394022.7; ENSP00000377590.3; ENSG00000136828.19 [Q5JS13-3]
ENST00000424082.6; ENSP00000415630.2; ENSG00000136828.19 [Q5JS13-7]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9649

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9649

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000259351.10; ENSP00000259351.5; NM_014636.3; NP_055451.1

UCSC genome browser

More...UCSCi		uc004bqo.3, human [Q5JS13-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF221098 mRNA Translation: AAF65253.1
AB002349 mRNA Translation: BAA20808.2 Different initiation.
AK299149 mRNA Translation: BAG61198.1
AL160169 Genomic DNA No translation available.
AL356862 Genomic DNA No translation available.
AL357623 Genomic DNA No translation available.
AL450263 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87645.1
CH471090 Genomic DNA Translation: EAW87646.1
CH471090 Genomic DNA Translation: EAW87648.1
BC019329 mRNA Translation: AAH19329.1 Different initiation.
BC032372 mRNA Translation: AAH32372.1
BC033708 mRNA Translation: AAH33708.1
CCDSiCCDS35143.1 [Q5JS13-1]
CCDS55344.1 [Q5JS13-4]
CCDS55345.1 [Q5JS13-7]
CCDS55346.1 [Q5JS13-2]
RefSeqiNP_001177657.1, NM_001190728.1 [Q5JS13-2]
NP_001177658.1, NM_001190729.1 [Q5JS13-7]
NP_001177659.1, NM_001190730.1 [Q5JS13-4]
NP_001309249.1, NM_001322320.1 [Q5JS13-7]
NP_055451.1, NM_014636.2 [Q5JS13-1]
XP_016870836.1, XM_017015347.1
XP_016870839.1, XM_017015350.1 [Q5JS13-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3QXLX-ray2.24A/B23-289[»]
AlphaFoldDBiQ5JS13
SMRiQ5JS13
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115007, 9 interactors
IntActiQ5JS13, 3 interactors
MINTiQ5JS13
STRINGi9606.ENSP00000259351

PTM databases

GlyGeniQ5JS13, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ5JS13
PhosphoSitePlusiQ5JS13

Genetic variation databases

BioMutaiRALGPS1
DMDMi189040074

Proteomic databases

EPDiQ5JS13
jPOSTiQ5JS13
MassIVEiQ5JS13
MaxQBiQ5JS13
PaxDbiQ5JS13
PeptideAtlasiQ5JS13
PRIDEiQ5JS13
ProteomicsDBi19273
63124 [Q5JS13-1]
63125 [Q5JS13-2]
63126 [Q5JS13-3]
63127 [Q5JS13-4]
63128 [Q5JS13-5]
63129 [Q5JS13-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30625, 71 antibodies from 17 providers

The DNASU plasmid repository

More...DNASUi		9649

Genome annotation databases

EnsembliENST00000259351.10; ENSP00000259351.5; ENSG00000136828.19
ENST00000373434.5; ENSP00000362533.1; ENSG00000136828.19 [Q5JS13-2]
ENST00000373436.5; ENSP00000362535.1; ENSG00000136828.19 [Q5JS13-4]
ENST00000394011.7; ENSP00000377579.3; ENSG00000136828.19 [Q5JS13-6]
ENST00000394022.7; ENSP00000377590.3; ENSG00000136828.19 [Q5JS13-3]
ENST00000424082.6; ENSP00000415630.2; ENSG00000136828.19 [Q5JS13-7]
GeneIDi9649
KEGGihsa:9649
MANE-SelectiENST00000259351.10; ENSP00000259351.5; NM_014636.3; NP_055451.1
UCSCiuc004bqo.3, human [Q5JS13-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9649
DisGeNETi9649

GeneCards: human genes, protein and diseases

More...GeneCardsi		RALGPS1
HGNCiHGNC:16851, RALGPS1
HPAiENSG00000136828, Low tissue specificity
MIMi614444, gene
neXtProtiNX_Q5JS13
OpenTargetsiENSG00000136828
PharmGKBiPA134907502
VEuPathDBiHostDB:ENSG00000136828

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3417, Eukaryota
GeneTreeiENSGT00940000154079
HOGENOMiCLU_021333_0_1_1
InParanoidiQ5JS13
OMAiGPCICAL
OrthoDBi343666at2759
PhylomeDBiQ5JS13
TreeFamiTF352150

Enzyme and pathway databases

PathwayCommonsiQ5JS13
SignaLinkiQ5JS13
SIGNORiQ5JS13

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9649, 13 hits in 1072 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RALGPS1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9649
PharosiQ5JS13, Tbio

Protein Ontology

More...PROi		PR:Q5JS13
RNActiQ5JS13, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000136828, Expressed in cortical plate and 215 other tissues
ExpressionAtlasiQ5JS13, baseline and differential
GenevisibleiQ5JS13, HS

Family and domain databases

CDDicd00155, RasGEF, 1 hit
Gene3Di1.10.840.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008937, Ras-like_GEF
IPR023578, Ras_GEF_dom_sf
IPR001895, RASGEF_cat_dom
IPR036964, RASGEF_cat_dom_sf
PANTHERiPTHR23113, PTHR23113, 1 hit
PfamiView protein in Pfam
PF00169, PH, 1 hit
PF00617, RasGEF, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00147, RasGEF, 1 hit
SUPFAMiSSF48366, SSF48366, 1 hit
PROSITEiView protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50009, RASGEF_CAT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGPS1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5JS13
Secondary accession number(s): B4DR86
, E9PBQ5, O15059, Q5JT60, Q5JT65, Q5JUG5, Q8N4S6, Q8N5H4, Q8WUV7, Q9NZ16
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: May 25, 2022
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again