Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (29 Sep 2021)
Sequence version 3 (01 May 2013)
Previous versions | rss
Add a publicationFeedback
Protein

Presequence protease, mitochondrial

Gene

PITRM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloendopeptidase of the mitochondrial matrix that functions in peptide cleavage and degradation rather than in protein processing (PubMed:10360838, PubMed:16849325, PubMed:19196155, PubMed:24931469).

Has an ATP-independent activity (PubMed:16849325).

Specifically cleaves peptides in the range of 5 to 65 residues (PubMed:19196155).

Shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference (PubMed:10360838, PubMed:19196155, PubMed:24931469).

Degrades the transit peptides of mitochondrial proteins after their cleavage (PubMed:19196155).

Also degrades other unstructured peptides (PubMed:19196155).

It is also able to degrade amyloid-beta protein 40, one of the peptides produced by APP processing, when it accumulates in mitochondrion (PubMed:16849325, PubMed:24931469).

It is a highly efficient protease, at least toward amyloid-beta protein 40 (PubMed:24931469).

Cleaves that peptide at a specific position and is probably not processive, releasing digested peptides intermediates that can be further cleaved subsequently (PubMed:24931469).

4 Publications

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+1 PublicationNote: Binds 1 zinc ion per subunit.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Mainly exists in a closed and catalytically competent conformation but a closed-to-open switch allows substrate entry into the catalytic chamber (PubMed:24931469). Substrate binding induces closure and dimerization (PubMed:24931469). A disulfide bond may lock the enzyme in a closed conformation preventing substrate entry into the catalytic chamber, participating in redox regulation of the enzyme (Probable). Inhibited by metal-chelating agents (PubMed:10360838). Inhibited by nickel and zinc excess, and slightly activated by manganese (PubMed:19196155).2 Publications3 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=1.07 µM for leumorphin ARG-ARG-GLN-PHE-LYS-VAL-VAL-THR-ARG-SER-GLN peptide (at pH 7.5)1 Publication
  2. KM=0.5 µM for TYR-GLY-GLY-LEU-ARG-ARG-GLY-GLN peptide (at pH 7.5)1 Publication

pH dependencei

Optimum pH is 7.7.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi104Zinc; via tele nitrogen; catalyticCombined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei107Proton acceptor2 Publications1
Metal bindingi108Zinc; via tele nitrogen; catalyticCombined sources1 Publication1
Metal bindingi205Zinc; catalyticCombined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.24.56, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5JRX3

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1268020, Mitochondrial protein import

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q5JRX3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q5JRX3

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M16.009

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Presequence protease, mitochondrial1 Publication (EC:3.4.24.-4 Publications)
Short name:
hPreP1 Publication
Alternative name(s):
Pitrilysin metalloproteinase 11 Publication
Short name:
Metalloprotease 11 Publication
Short name:
hMP11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PITRM1Imported
Synonyms:KIAA1104Imported, MP11 Publication, PREP1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17663, PITRM1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618211, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5JRX3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000107959

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1 – 15Missing : Loss of localization to the mitochondrion. 1 PublicationAdd BLAST15
Mutagenesisi107E → Q: Loss of metalloendopeptidase activity. 2 Publications1
Mutagenesisi119C → S: No loss of metalloendopeptidase activity under oxidizing conditions. 1 Publication1
Mutagenesisi557L → E: Decreased metalloendopeptidase activity without effect on protein stability. 1 Publication1
Mutagenesisi558P → G: Decreased metalloendopeptidase activity without effect on protein stability. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10531

Open Targets

More...
OpenTargetsi
ENSG00000107959

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134902269

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5JRX3, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3124731

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PITRM1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
485956568

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 28MitochondrionSequence analysisAdd BLAST28
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024993129 – 1037Presequence protease, mitochondrialAdd BLAST1009

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi119 ↔ 5561 Publication
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei759N6-acetyllysineBy similarity1
Modified residuei770N6-acetyllysine; alternateBy similarity1
Modified residuei770N6-succinyllysine; alternateBy similarity1
Modified residuei849N6-succinyllysineBy similarity1
Modified residuei884N6-acetyllysineBy similarity1
Modified residuei946N6-succinyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A disulfide bond locks the enzyme in the closed conformation preventing substrate entry into the catalytic chamber.2 Publications

Keywords - PTMi

Acetylation, Disulfide bond

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5JRX3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5JRX3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5JRX3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5JRX3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5JRX3

PeptideAtlas

More...
PeptideAtlasi
Q5JRX3

PRoteomics IDEntifications database

More...
PRIDEi
Q5JRX3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
11495
17899
63119 [Q5JRX3-1]
63120 [Q5JRX3-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q5JRX3, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5JRX3

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q5JRX3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5JRX3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5JRX3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at higher level in muscle and heart compared to brain, pancreas, liver, lung and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000107959, Expressed in left lobe of thyroid gland and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5JRX3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5JRX3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000107959, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer and homodimer; homodimerization is induced by binding of the substrate.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115786, 107 interactors

Database of interacting proteins

More...
DIPi
DIP-52900N

Protein interaction database and analysis system

More...
IntActi
Q5JRX3, 21 interactors

Molecular INTeraction database

More...
MINTi
Q5JRX3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370377

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q5JRX3

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5JRX3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11037
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5JRX3

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni804 – 834DisorderedSequence analysisAdd BLAST31

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M16 family. PreP subfamily.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2019, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018381

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009165_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5JRX3

Identification of Orthologs from Complete Genome Data

More...
OMAi
SVFQGVD

Database of Orthologous Groups

More...
OrthoDBi
107079at2759

TreeFam database of animal gene trees

More...
TreeFami
TF300333

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011249, Metalloenz_LuxS/M16
IPR011765, Pept_M16_N
IPR007863, Peptidase_M16_C
IPR013578, Peptidase_M16C_assoc

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08367, M16C_assoc, 1 hit
PF00675, Peptidase_M16, 1 hit
PF05193, Peptidase_M16_C, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01264, M16C_associated, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63411, SSF63411, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 20 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5JRX3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWRCGGRQGL CVLRRLSGGH AHHRAWRWNS NRACERALQY KLGDKIHGFT
60 70 80 90 100
VNQVTSVPEL FLTAVKLTHD DTGARYLHLA REDTNNLFSV QFRTTPMDST
110 120 130 140 150
GVPHILEHTV LCGSQKYPCR DPFFKMLNRS LSTFMNAFTA SDYTLYPFST
160 170 180 190 200
QNPKDFQNLL SVYLDATFFP CLRELDFWQE GWRLEHENPS DPQTPLVFKG
210 220 230 240 250
VVFNEMKGAF TDNERIFSQH LQNRLLPDHT YSVVSGGDPL CIPELTWEQL
260 270 280 290 300
KQFHATHYHP SNARFFTYGN FPLEQHLKQI HEEALSKFQK IEPSTVVPAQ
310 320 330 340 350
TPWDKPREFQ ITCGPDSFAT DPSKQTTISV SFLLPDITDT FEAFTLSLLS
360 370 380 390 400
SLLTSGPNSP FYKALIESGL GTDFSPDVGY NGYTREAYFS VGLQGIAEKD
410 420 430 440 450
IETVRSLIDR TIDEVVEKGF EDDRIEALLH KIEIQMKHQS TSFGLMLTSY
460 470 480 490 500
IASCWNHDGD PVELLKLGNQ LAKFRQCLQE NPKFLQEKVK QYFKNNQHKL
510 520 530 540 550
TLSMRPDDKY HEKQAQVEAT KLKQKVEALS PGDRQQIYEK GLELRSQQSK
560 570 580 590 600
PQDASCLPAL KVSDIEPTIP VTELDVVLTA GDIPVQYCAQ PTNGMVYFRA
610 620 630 640 650
FSSLNTLPEE LRPYVPLFCS VLTKLGCGLL DYREQAQQIE LKTGGMSASP
660 670 680 690 700
HVLPDDSHMD TYEQGVLFSS LCLDRNLPDM MQLWSEIFNN PCFEEEEHFK
710 720 730 740 750
VLVKMTAQEL ANGIPDSGHL YASIRAGRTL TPAGDLQETF SGMDQVRLMK
760 770 780 790 800
RIAEMTDIKP ILRKLPRIKK HLLNGDNMRC SVNATPQQMP QTEKAVEDFL
810 820 830 840 850
RSIGRSKKER RPVRPHTVEK PVPSSSGGDA HVPHGSQVIR KLVMEPTFKP
860 870 880 890 900
WQMKTHFLMP FPVNYVGECI RTVPYTDPDH ASLKILARLM TAKFLHTEIR
910 920 930 940 950
EKGGAYGGGA KLSHNGIFTL YSYRDPNTIE TLQSFGKAVD WAKSGKFTQQ
960 970 980 990 1000
DIDEAKLSVF STVDAPVAPS DKGMDHFLYG LSDEMKQAHR EQLFAVSHDK
1010 1020 1030
LLAVSDRYLG TGKSTHGLAI LGPENPKIAK DPSWIIQ
Length:1,037
Mass (Da):117,413
Last modified:May 1, 2013 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF488389F0E219718
GO
Isoform 2 (identifier: Q5JRX3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     664-664: Q → QV

Show »
Length:1,038
Mass (Da):117,512
Checksum:i8A55B3A43B434A4E
GO
Isoform 3 (identifier: Q5JRX3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MWRCGGRQGLCVLRRLSGGHAHHRAWRWNSNRACERALQYKLGDKIHGFTVNQ → MRNVALRRAAGPVCAEAAERR
     624-689: Missing.

Show »
Length:939
Mass (Da):106,065
Checksum:i21E09CEE32236867
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 20 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRX9A0A0A0MRX9_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
832Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V4N3A0A7I2V4N3_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
486Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V397A0A7I2V397_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
971Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V3B6A0A7I2V3B6_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
926Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V5C6A0A7I2V5C6_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
992Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V5H2A0A7I2V5H2_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
995Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2YQT2A0A7I2YQT2_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
1,021Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2YQX5A0A7I2YQX5_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
996Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4F7H0Y4F7_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
596Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V3X0A0A7I2V3X0_HUMAN
Pitrilysin metalloproteinase 1
PITRM1
777Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH01150 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAI39997 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti121D → N in AAC67244 (PubMed:10360838).Curated1
Sequence conflicti211T → V in CAI40001 (PubMed:15164054).Curated1
Sequence conflicti212D → N in CAI40001 (PubMed:15164054).Curated1
Sequence conflicti373D → E in AAC67244 (PubMed:10360838).Curated1
Sequence conflicti418 – 420KGF → TRI in AAC67244 (PubMed:10360838).Curated3
Sequence conflicti883 – 884LK → FE in AAH95422 (PubMed:15489334).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0275178Q → R1 PublicationCorresponds to variant dbSNP:rs11818724Ensembl.1
Natural variantiVAR_027518145L → V1 PublicationCorresponds to variant dbSNP:rs9423502Ensembl.1
Natural variantiVAR_027519169F → S1 PublicationCorresponds to variant dbSNP:rs3814596Ensembl.1
Natural variantiVAR_027520328I → V3 PublicationsCorresponds to variant dbSNP:rs4242746Ensembl.1
Natural variantiVAR_027521397A → V3 PublicationsCorresponds to variant dbSNP:rs3182535Ensembl.1
Natural variantiVAR_027522516Q → H. Corresponds to variant dbSNP:rs3765101Ensembl.1
Natural variantiVAR_057059554A → D. Corresponds to variant dbSNP:rs12248937Ensembl.1
Natural variantiVAR_027523621V → I1 PublicationCorresponds to variant dbSNP:rs2388556Ensembl.1
Natural variantiVAR_057060805R → Q. Corresponds to variant dbSNP:rs34837384EnsemblClinVar.1
Natural variantiVAR_027524952I → M. Corresponds to variant dbSNP:rs2279219EnsemblClinVar.1
Natural variantiVAR_027525963V → I1 PublicationCorresponds to variant dbSNP:rs17849904Ensembl.1
Natural variantiVAR_027526969P → L. Corresponds to variant dbSNP:rs2279218Ensembl.1
Natural variantiVAR_0275271037Q → RCombined sources4 PublicationsCorresponds to variant dbSNP:rs6901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0464941 – 53MWRCG…FTVNQ → MRNVALRRAAGPVCAEAAER R in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_046495624 – 689Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_020597664Q → QV in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF061243 mRNA Translation: AAC67244.1
AK002061 mRNA Translation: BAG51008.1
AK303406 mRNA Translation: BAG64460.1
AL451164 Genomic DNA Translation: CAI40001.1
AL451164 Genomic DNA Translation: CAI39997.1 Sequence problems.
BC001150 mRNA Translation: AAH01150.1 Different initiation.
BC005025 mRNA Translation: AAH05025.1
BC095422 mRNA Translation: AAH95422.1
BC111987 mRNA Translation: AAI11988.1
BC113369 mRNA Translation: AAI13370.1
AB029027 mRNA Translation: BAA83056.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55699.1 [Q5JRX3-2]
CCDS55700.1 [Q5JRX3-3]
CCDS59208.1 [Q5JRX3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001229236.1, NM_001242307.1 [Q5JRX3-2]
NP_001229238.1, NM_001242309.1 [Q5JRX3-3]
NP_055704.2, NM_014889.3 [Q5JRX3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000224949; ENSP00000224949; ENSG00000107959 [Q5JRX3-1]
ENST00000380989; ENSP00000370377; ENSG00000107959 [Q5JRX3-2]
ENST00000451104; ENSP00000401201; ENSG00000107959 [Q5JRX3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10531

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10531

UCSC genome browser

More...
UCSCi
uc001igt.3, human [Q5JRX3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF061243 mRNA Translation: AAC67244.1
AK002061 mRNA Translation: BAG51008.1
AK303406 mRNA Translation: BAG64460.1
AL451164 Genomic DNA Translation: CAI40001.1
AL451164 Genomic DNA Translation: CAI39997.1 Sequence problems.
BC001150 mRNA Translation: AAH01150.1 Different initiation.
BC005025 mRNA Translation: AAH05025.1
BC095422 mRNA Translation: AAH95422.1
BC111987 mRNA Translation: AAI11988.1
BC113369 mRNA Translation: AAI13370.1
AB029027 mRNA Translation: BAA83056.2
CCDSiCCDS55699.1 [Q5JRX3-2]
CCDS55700.1 [Q5JRX3-3]
CCDS59208.1 [Q5JRX3-1]
RefSeqiNP_001229236.1, NM_001242307.1 [Q5JRX3-2]
NP_001229238.1, NM_001242309.1 [Q5JRX3-3]
NP_055704.2, NM_014889.3 [Q5JRX3-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4L3TX-ray2.03A/B33-1037[»]
4NGEX-ray2.70A/D33-1037[»]
4RPUX-ray2.27A/B33-1037[»]
SMRiQ5JRX3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115786, 107 interactors
DIPiDIP-52900N
IntActiQ5JRX3, 21 interactors
MINTiQ5JRX3
STRINGi9606.ENSP00000370377

Chemistry databases

BindingDBiQ5JRX3
ChEMBLiCHEMBL3124731

Protein family/group databases

MEROPSiM16.009

PTM databases

GlyGeniQ5JRX3, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ5JRX3
MetOSiteiQ5JRX3
PhosphoSitePlusiQ5JRX3
SwissPalmiQ5JRX3

Genetic variation databases

BioMutaiPITRM1
DMDMi485956568

Proteomic databases

EPDiQ5JRX3
jPOSTiQ5JRX3
MassIVEiQ5JRX3
MaxQBiQ5JRX3
PaxDbiQ5JRX3
PeptideAtlasiQ5JRX3
PRIDEiQ5JRX3
ProteomicsDBi11495
17899
63119 [Q5JRX3-1]
63120 [Q5JRX3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1721, 188 antibodies

The DNASU plasmid repository

More...
DNASUi
10531

Genome annotation databases

EnsembliENST00000224949; ENSP00000224949; ENSG00000107959 [Q5JRX3-1]
ENST00000380989; ENSP00000370377; ENSG00000107959 [Q5JRX3-2]
ENST00000451104; ENSP00000401201; ENSG00000107959 [Q5JRX3-3]
GeneIDi10531
KEGGihsa:10531
UCSCiuc001igt.3, human [Q5JRX3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10531
DisGeNETi10531

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PITRM1
HGNCiHGNC:17663, PITRM1
HPAiENSG00000107959, Low tissue specificity
MIMi618211, gene
neXtProtiNX_Q5JRX3
OpenTargetsiENSG00000107959
PharmGKBiPA134902269
VEuPathDBiHostDB:ENSG00000107959

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2019, Eukaryota
GeneTreeiENSGT00390000018381
HOGENOMiCLU_009165_0_0_1
InParanoidiQ5JRX3
OMAiSVFQGVD
OrthoDBi107079at2759
TreeFamiTF300333

Enzyme and pathway databases

BRENDAi3.4.24.56, 2681
PathwayCommonsiQ5JRX3
ReactomeiR-HSA-1268020, Mitochondrial protein import
SignaLinkiQ5JRX3
SIGNORiQ5JRX3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
10531, 192 hits in 1034 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PITRM1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PITRM1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10531
PharosiQ5JRX3, Tchem

Protein Ontology

More...
PROi
PR:Q5JRX3
RNActiQ5JRX3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000107959, Expressed in left lobe of thyroid gland and 236 other tissues
ExpressionAtlasiQ5JRX3, baseline and differential
GenevisibleiQ5JRX3, HS

Family and domain databases

InterProiView protein in InterPro
IPR011249, Metalloenz_LuxS/M16
IPR011765, Pept_M16_N
IPR007863, Peptidase_M16_C
IPR013578, Peptidase_M16C_assoc
PfamiView protein in Pfam
PF08367, M16C_assoc, 1 hit
PF00675, Peptidase_M16, 1 hit
PF05193, Peptidase_M16_C, 2 hits
SMARTiView protein in SMART
SM01264, M16C_associated, 1 hit
SUPFAMiSSF63411, SSF63411, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPREP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5JRX3
Secondary accession number(s): B3KMJ6
, B4E0J8, C9JSL2, E7ES23, O95204, Q2M2G6, Q4VBR1, Q5JRW7, Q7L5Z7, Q9BSI6, Q9BVJ5, Q9UPP8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: May 1, 2013
Last modified: September 29, 2021
This is version 153 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again