Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (05 Jun 2019)
Sequence version 1 (15 Feb 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transport and Golgi organization protein 1 homolog

Gene

MIA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. It may participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. It is also specifically required for the secretion of lipoproteins by participating in their export from the endoplasmic reticulum (PubMed:27138255, PubMed:19269366). Required for correct assembly of COPII coat components at endoplasmic reticulum exit sites (ERES) and for the localization of SEC16A and membrane-bound ER-resident complexes consisting of MIA2 and PREB/SEC12 to ERES (PubMed:28442536).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cargo receptor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Exocytosis, Protein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5694530 Cargo concentration in the ER
R-HSA-8957275 Post-translational protein phosphorylation

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.113.1.2 the collagen secretory protein, mia3 (mia3) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transport and Golgi organization protein 1 homologCurated
Short name:
TANGO11 Publication
Alternative name(s):
C219-reactive peptide1 Publication
D3201 Publication
Melanoma inhibitory activity protein 3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MIA3Imported
Synonyms:KIAA0268Imported, TANGO1 Publication
ORF Names:UNQ6077/PRO20088
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24008 MIA3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613455 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5JRA6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini23 – 1144LumenalSequence analysisAdd BLAST1122
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei1145 – 1165Sequence analysisAdd BLAST21
Topological domaini1166 – 1176LumenalSequence analysisAdd BLAST11
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1177 – 1197HelicalSequence analysisAdd BLAST21
Topological domaini1198 – 1907CytoplasmicSequence analysisAdd BLAST710

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
375056

Open Targets

More...
OpenTargetsi
ENSG00000154305

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485536

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MIA3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74741823

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000028899823 – 1907Transport and Golgi organization protein 1 homologAdd BLAST1885

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei226Phosphoserine; by FAM20C1 Publication1
Modified residuei229Phosphoserine; by FAM20C1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi246N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi589N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei727PhosphoserineCombined sources1
Modified residuei876PhosphoserineCombined sources1
Modified residuei1067PhosphoserineCombined sources1
Modified residuei1431PhosphoserineBy similarity1
Modified residuei1666PhosphoserineBy similarity1
Modified residuei1678PhosphoserineBy similarity1
Modified residuei1706PhosphoserineCombined sources1
Modified residuei1727PhosphoserineBy similarity1
Modified residuei1741PhosphoserineBy similarity1
Modified residuei1745PhosphoserineCombined sources1
Modified residuei1784Asymmetric dimethylarginineBy similarity1
Modified residuei1892PhosphoserineBy similarity1
Modified residuei1906Phosphoserine; by FAM20CCombined sources1 Publication1

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5JRA6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5JRA6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5JRA6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5JRA6

PeptideAtlas

More...
PeptideAtlasi
Q5JRA6

PRoteomics IDEntifications database

More...
PRIDEi
Q5JRA6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
63078
63079 [Q5JRA6-2]
63080 [Q5JRA6-3]
63081 [Q5JRA6-4]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1498

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5JRA6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5JRA6

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q5JRA6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000154305 Expressed in 217 organ(s), highest expression level in stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5JRA6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5JRA6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA055922
HPA056816

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MIA2 (PubMed:21525241). Interacts (via SH3 domain) with COL7A1 (PubMed:19269366). Interacts with the COPII coat subunits SEC23A, SEC23B and maybe SEC24C (PubMed:19269366, PubMed:27551091, PubMed:28442536). May interact with APOB and MIA2 (PubMed:27138255). Isoform 1 and isoform 4 interact with SEC16A (PubMed:28442536).5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
131952, 62 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q5JRA6

Protein interaction database and analysis system

More...
IntActi
Q5JRA6, 29 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000340900

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5JRA6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 107SH3PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1211 – 1650Mediates interaction with MIA21 PublicationAdd BLAST440
Regioni1751 – 1907Proline-rich domain (PRD); mediates interaction with the COPII coat subunits SEC23A and SEC23B3 PublicationsAdd BLAST157
Regioni1788 – 1847SEC16A-interacting region (SIR); required for its localization to endoplasmic reticulum exit sites and for its interaction with SEC16A1 PublicationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili471 – 531Sequence analysisAdd BLAST61
Coiled coili1214 – 1396Sequence analysisAdd BLAST183
Coiled coili1487 – 1639Sequence analysisAdd BLAST153

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1640 – 1890Pro-richAdd BLAST251

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The proline-rich domain (PRD) contains repeated PPP motifs. A single PPP motif is necessary and sufficient to mediate interaction with the COPII coat subunits SEC23A and SEC23B.2 Publications
Although 2 transmembrane domains are predicted, PubMed:19269366 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MIA/OTOR family. Tango1 subfamily.Curated

Keywords - Domaini

Coiled coil, SH3 domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFUG Eukaryota
ENOG410YVAS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182767

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5JRA6

Identification of Orthologs from Complete Genome Data

More...
OMAi
FGPGMRP

Database of Orthologous Groups

More...
OrthoDBi
208382at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5JRA6

TreeFam database of animal gene trees

More...
TreeFami
TF333137

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07653 SH3_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5JRA6-1) [UniParc]FASTAAdd to basket
Also known as: TANGO1L1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAPGLLVW LLVLRLPWRV PGQLDPSTGR RFSEHKLCAD DECSMLMYRG
60 70 80 90 100
EALEDFTGPD CRFVNFKKGD PVYVYYKLAR GWPEVWAGSV GRTFGYFPKD
110 120 130 140 150
LIQVVHEYTK EELQVPTDET DFVCFDGGRD DFHNYNVEEL LGFLELYNSA
160 170 180 190 200
ATDSEKAVEK TLQDMEKNPE LSKEREPEPE PVEANSEESD SVFSENTEDL
210 220 230 240 250
QEQFTTQKHH SHANSQANHA QGEQASFESF EEMLQDKLKV PESENNKTSN
260 270 280 290 300
SSQVSNEQDK IDAYKLLKKE MTLDLKTKFG STADALVSDD ETTRLVTSLE
310 320 330 340 350
DDFDEELDTE YYAVGKEDEE NQEDFDELPL LTFTDGEDMK TPAKSGVEKY
360 370 380 390 400
PTDKEQNSNE EDKVQLTVPP GIKNDDKNIL TTWGDTIFSI VTGGEETRDT
410 420 430 440 450
MDLESSSSEE EKEDDDDALV PDSKQGKPQS ATDYSDPDNV DDGLFIVDIP
460 470 480 490 500
KTNNDKEVNA EHHIKGKGRG VQESKRGLVQ DKTELEDENQ EGMTVHSSVH
510 520 530 540 550
SNNLNSMPAA EKGKDTLKSA YDDTENDLKG AAIHISKGML HEEKPGEQIL
560 570 580 590 600
EGGSESESAQ KAAGNQMNDR KIQQESLGSA PLMGDDHPNA SRDSVEGDAL
610 620 630 640 650
VNGAKLHTLS VEHQREELKE ELVLKTQNQP RFSSPDEIDL PRELEDEVPI
660 670 680 690 700
LGRNLPWQQE RDVAATASKQ MSEKIRLSEG EAKEDSLDEE FFHHKAMQGT
710 720 730 740 750
EVGQTDQTDS TGGPAFLSKV EEDDYPSEEL LEDENAINAK RSKEKNPGNQ
760 770 780 790 800
GRQFDVNLQV PDRAVLGTIH PDPEIEESKQ ETSMILDSEK TSETAAKGVN
810 820 830 840 850
TGGREPNTMV EKERPLADKK AQRPFERSDF SDSIKIQTPE LGEVFQNKDS
860 870 880 890 900
DYLKNDNPEE HLKTSGLAGE PEGELSKEDH ENTEKYMGTE SQGSAAAEPE
910 920 930 940 950
DDSFHWTPHT SVEPGHSDKR EDLLIISSFF KEQQSLQRFQ KYFNVHELEA
960 970 980 990 1000
LLQEMSSKLK SAQQESLPYN MEKVLDKVFR ASESQILSIA EKMLDTRVAE
1010 1020 1030 1040 1050
NRDLGMNENN IFEEAAVLDD IQDLIYFVRY KHSTAEETAT LVMAPPLEEG
1060 1070 1080 1090 1100
LGGAMEEMQP LHEDNFSREK TAELNVQVPE EPTHLDQRVI GDTHASEVSQ
1110 1120 1130 1140 1150
KPNTEKDLDP GPVTTEDTPM DAIDANKQPE TAAEEPASVT PLENAILLIY
1160 1170 1180 1190 1200
SFMFYLTKSL VATLPDDVQP GPDFYGLPWK PVFITAFLGI ASFAIFLWRT
1210 1220 1230 1240 1250
VLVVKDRVYQ VTEQQISEKL KTIMKENTEL VQKLSNYEQK IKESKKHVQE
1260 1270 1280 1290 1300
TRKQNMILSD EAIKYKDKIK TLEKNQEILD DTAKNLRVML ESEREQNVKN
1310 1320 1330 1340 1350
QDLISENKKS IEKLKDVISM NASEFSEVQI ALNEAKLSEE KVKSECHRVQ
1360 1370 1380 1390 1400
EENARLKKKK EQLQQEIEDW SKLHAELSEQ IKSFEKSQKD LEVALTHKDD
1410 1420 1430 1440 1450
NINALTNCIT QLNLLECESE SEGQNKGGND SDELANGEVG GDRNEKMKNQ
1460 1470 1480 1490 1500
IKQMMDVSRT QTAISVVEED LKLLQLKLRA SVSTKCNLED QVKKLEDDRN
1510 1520 1530 1540 1550
SLQAAKAGLE DECKTLRQKV EILNELYQQK EMALQKKLSQ EEYERQEREH
1560 1570 1580 1590 1600
RLSAADEKAV SAAEEVKTYK RRIEEMEDEL QKTERSFKNQ IATHEKKAHE
1610 1620 1630 1640 1650
NWLKARAAER AIAEEKREAA NLRHKLLELT QKMAMLQEEP VIVKPMPGKP
1660 1670 1680 1690 1700
NTQNPPRRGP LSQNGSFGPS PVSGGECSPP LTVEPPVRPL SATLNRRDMP
1710 1720 1730 1740 1750
RSEFGSVDGP LPHPRWSAEA SGKPSPSDPG SGTATMMNSS SRGSSPTRVL
1760 1770 1780 1790 1800
DEGKVNMAPK GPPPFPGVPL MSTPMGGPVP PPIRYGPPPQ LCGPFGPRPL
1810 1820 1830 1840 1850
PPPFGPGMRP PLGLREFAPG VPPGRRDLPL HPRGFLPGHA PFRPLGSLGP
1860 1870 1880 1890 1900
REYFIPGTRL PPPTHGPQEY PPPPAVRDLL PSGSRDEPPP ASQSTSQDCS

QALKQSP
Length:1,907
Mass (Da):213,702
Last modified:February 15, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD19C9AF1656F4B1C
GO
Isoform 2 (identifier: Q5JRA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1362: Missing.

Show »
Length:1,848
Mass (Da):206,890
Checksum:iB793E3992499E137
GO
Isoform 3 (identifier: Q5JRA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-500: MTVHSSVH → FKTEPIKL
     501-1907: Missing.

Show »
Length:500
Mass (Da):56,584
Checksum:iF785E148171092E6
GO
Isoform 4 (identifier: Q5JRA6-4) [UniParc]FASTAAdd to basket
Also known as: TANGO1S1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-1122: Missing.
     1123-1159: IDANKQPETAAEEPASVTPLENAILLIYSFMFYLTKS → MDSVPATVPSIAATPGDPELVGPLSVLYAAFIAKLLE

Show »
Length:785
Mass (Da):87,438
Checksum:i0A3890131D1BA2D5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRH6A0A0A0MRH6_HUMAN
Transport and Golgi organization pr...
MIA3
1,015Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0T4H7C0T4_HUMAN
Transport and Golgi organization pr...
MIA3
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC04810 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAF83024 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46Missing in AAQ89449 (PubMed:12975309).Curated1
Sequence conflicti1032H → R in BAC04810 (PubMed:14702039).Curated1
Sequence conflicti1443R → Q in AAH47116 (PubMed:15489334).Curated1
Sequence conflicti1754K → R in BAH12416 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032546482K → E1 PublicationCorresponds to variant dbSNP:rs2936053Ensembl.1
Natural variantiVAR_032547605K → R. Corresponds to variant dbSNP:rs2936052Ensembl.1
Natural variantiVAR_032548881E → G1 PublicationCorresponds to variant dbSNP:rs2936051Ensembl.1
Natural variantiVAR_0325491659G → C1 PublicationCorresponds to variant dbSNP:rs17857325Ensembl.1
Natural variantiVAR_0325501723K → E1 PublicationCorresponds to variant dbSNP:rs17854428Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258601 – 1122Missing in isoform 4. 1 PublicationAdd BLAST1122
Alternative sequenceiVSP_025861493 – 500MTVHSSVH → FKTEPIKL in isoform 3. 1 Publication8
Alternative sequenceiVSP_025862501 – 1907Missing in isoform 3. 1 PublicationAdd BLAST1407
Alternative sequenceiVSP_0258631123 – 1159IDANK…YLTKS → MDSVPATVPSIAATPGDPEL VGPLSVLYAAFIAKLLE in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0258641304 – 1362Missing in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY359091 mRNA Translation: AAQ89449.1
AK096526 mRNA Translation: BAC04810.1 Different initiation.
AK290335 mRNA Translation: BAF83024.1 Different initiation.
AK296712 mRNA Translation: BAH12416.1
AL592148 Genomic DNA No translation available.
D87742 mRNA Translation: BAA13448.1
L34688 mRNA Translation: AAB00324.1
DQ166034 mRNA Translation: AAZ95512.1
BC047116 mRNA Translation: AAH47116.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41470.1 [Q5JRA6-1]
CCDS73035.1 [Q5JRA6-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001287796.1, NM_001300867.1 [Q5JRA6-4]
NP_001310992.1, NM_001324063.1 [Q5JRA6-2]
NP_940953.2, NM_198551.3 [Q5JRA6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340535; ENSP00000345866; ENSG00000154305 [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305 [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305 [Q5JRA6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
375056

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:375056

UCSC genome browser

More...
UCSCi
uc001hnl.4 human [Q5JRA6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY359091 mRNA Translation: AAQ89449.1
AK096526 mRNA Translation: BAC04810.1 Different initiation.
AK290335 mRNA Translation: BAF83024.1 Different initiation.
AK296712 mRNA Translation: BAH12416.1
AL592148 Genomic DNA No translation available.
D87742 mRNA Translation: BAA13448.1
L34688 mRNA Translation: AAB00324.1
DQ166034 mRNA Translation: AAZ95512.1
BC047116 mRNA Translation: AAH47116.2
CCDSiCCDS41470.1 [Q5JRA6-1]
CCDS73035.1 [Q5JRA6-4]
RefSeqiNP_001287796.1, NM_001300867.1 [Q5JRA6-4]
NP_001310992.1, NM_001324063.1 [Q5JRA6-2]
NP_940953.2, NM_198551.3 [Q5JRA6-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KYNX-ray2.55C1796-1803[»]
5KYUX-ray3.51C1796-1803[»]
5KYWX-ray3.20C1800-1808[»]
SMRiQ5JRA6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131952, 62 interactors
CORUMiQ5JRA6
IntActiQ5JRA6, 29 interactors
STRINGi9606.ENSP00000340900

Protein family/group databases

TCDBi9.B.113.1.2 the collagen secretory protein, mia3 (mia3) family

PTM databases

GlyConnecti1498
iPTMnetiQ5JRA6
PhosphoSitePlusiQ5JRA6

Polymorphism and mutation databases

BioMutaiMIA3
DMDMi74741823

Proteomic databases

EPDiQ5JRA6
jPOSTiQ5JRA6
MaxQBiQ5JRA6
PaxDbiQ5JRA6
PeptideAtlasiQ5JRA6
PRIDEiQ5JRA6
ProteomicsDBi63078
63079 [Q5JRA6-2]
63080 [Q5JRA6-3]
63081 [Q5JRA6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340535; ENSP00000345866; ENSG00000154305 [Q5JRA6-4]
ENST00000344507; ENSP00000341348; ENSG00000154305 [Q5JRA6-3]
ENST00000344922; ENSP00000340900; ENSG00000154305 [Q5JRA6-1]
GeneIDi375056
KEGGihsa:375056
UCSCiuc001hnl.4 human [Q5JRA6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
375056
DisGeNETi375056

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MIA3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0001613
HGNCiHGNC:24008 MIA3
HPAiHPA055922
HPA056816
MIMi613455 gene
neXtProtiNX_Q5JRA6
OpenTargetsiENSG00000154305
PharmGKBiPA143485536

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFUG Eukaryota
ENOG410YVAS LUCA
GeneTreeiENSGT00950000182767
InParanoidiQ5JRA6
OMAiFGPGMRP
OrthoDBi208382at2759
PhylomeDBiQ5JRA6
TreeFamiTF333137

Enzyme and pathway databases

ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-5694530 Cargo concentration in the ER
R-HSA-8957275 Post-translational protein phosphorylation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MIA3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
375056
PMAP-CutDBiQ5JRA6

Protein Ontology

More...
PROi
PR:Q5JRA6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000154305 Expressed in 217 organ(s), highest expression level in stomach
ExpressionAtlasiQ5JRA6 baseline and differential
GenevisibleiQ5JRA6 HS

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF07653 SH3_2, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTGO1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5JRA6
Secondary accession number(s): A8K2S0
, A8MT05, A8MT13, B7Z430, Q14083, Q3S4X3, Q5JRA5, Q5JRB0, Q5JRB1, Q5JRB2, Q6UVY8, Q86Y60, Q8N8M5, Q92580
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: February 15, 2005
Last modified: June 5, 2019
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again