Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (17 Jun 2020)
Sequence version 2 (24 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc transporter 9

Gene

Slc30a9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a zinc transporter involved in intracellular zinc homeostasis (By similarity). Functions as a secondary coactivator for nuclear receptors by cooperating with p160 coactivators subtypes (PubMed:15988012). Plays a role in transcriptional activation of Wnt-responsive genes (PubMed:17344318).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cation transmembrane transporter activity Source: InterPro
  • chromatin binding Source: MGI
  • nuclear receptor binding Source: MGI
  • nuclear receptor transcription coactivator activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transcription, Transcription regulation, Transport, Zinc transport
LigandZinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc transporter 9
Short name:
ZnT-9
Alternative name(s):
GRIP1-associated coactivator 63
Short name:
GAC63
Solute carrier family 30 member 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc30a9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923690 Slc30a9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Transmembranei313 – 333HelicalSequence analysisAdd BLAST21
Transmembranei341 – 361HelicalSequence analysisAdd BLAST21
Transmembranei391 – 411HelicalSequence analysisAdd BLAST21
Transmembranei423 – 443HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002958061 – 567Zinc transporter 9Add BLAST567

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5IRJ6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5IRJ6

PeptideAtlas

More...
PeptideAtlasi
Q5IRJ6

PRoteomics IDEntifications database

More...
PRIDEi
Q5IRJ6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5IRJ6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5IRJ6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029221 Expressed in cumulus cell and 285 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5IRJ6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GRIP1, ESR1, AR and CTNNB1.

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000124047

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5IRJ6 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5IRJ6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi461 – 465LXXLL motif5

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2802 Eukaryota
COG0053 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008346

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5IRJ6

KEGG Orthology (KO)

More...
KOi
K14696

Database of Orthologous Groups

More...
OrthoDBi
667718at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5IRJ6

TreeFam database of animal gene trees

More...
TreeFami
TF314526

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1510.10, 1 hit
3.90.530.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002524 Cation_efflux
IPR027469 Cation_efflux_TMD_sf
IPR009061 DNA-bd_dom_put_sf
IPR040177 SLC30A9
IPR037129 XPA_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13414 PTHR13414, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01545 Cation_efflux, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF161111 SSF161111, 1 hit
SSF46955 SSF46955, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01297 CDF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5IRJ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFPGLAAAAA AHRCSWAALC RLGGGRAATR GRSQGWKNVM TFESFTYVVP
60 70 80 90 100
DIHPHLSIIN QVKLYSTNVQ KGGQGSQTPK ADKVPSLTQT VENIGAELKA
110 120 130 140 150
PLKQDPLQVR VKAVLKKRDY GSKYTKNNFI TGVRAINEFC LKSSDLEQLR
160 170 180 190 200
KIRRRSPHDD TESFTVFLRS DVEAKALEVW GSLEALAREK KLRKEAEIEY
210 220 230 240 250
RERLFRNQRI LREYGDFLGN TKPRSRAVSV FLKGPGKVVM VAICINGLNC
260 270 280 290 300
FFKFLAWIYT GSASMFSEAI HSLSDTCNQG LLALGISKSV QTPDPSHPYG
310 320 330 340 350
FSNMRYISSL ISGVGIFMMG AGLSWYHGIM GLLHPQPMES LLWAYCILAG
360 370 380 390 400
SLVSEGATLL VAINELRRSA QAKGTTFYKY VMESRDPSTN VILLEDTAAV
410 420 430 440 450
LGVIIAATCM GLTSITGNPL YDSLGSLGVG TLLGVVSAFL IYTNTEALLG
460 470 480 490 500
RSIQPEQVQR LTELLESDPS VRAIHDVKAT DLGLGKVRFK AEVDFDGRVV
510 520 530 540 550
TRSYLEKQDF DQMMQEIQEV KTPEQLEAFM LKHGENIIDT LGAEVDRLEK
560
ELKKRNPEVR HVDLEIL
Length:567
Mass (Da):62,875
Last modified:July 24, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i64105C5D7D7D9A64
GO
Isoform 2 (identifier: Q5IRJ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MFPGLA → MESVGAAGGSEAGGGVRVGASAPPGCFRAWP

Show »
Length:592
Mass (Da):65,130
Checksum:iB2E1EEF753A7E4EE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WHL1F8WHL1_MOUSE
Zinc transporter 9
Slc30a9
547Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YVB0A0A0J9YVB0_MOUSE
Zinc transporter 9
Slc30a9
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YV89A0A0J9YV89_MOUSE
Zinc transporter 9
Slc30a9
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YU90A0A0J9YU90_MOUSE
Zinc transporter 9
Slc30a9
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti35 – 38GWKN → HASD in AAH27806 (PubMed:15489334).Curated4
Sequence conflicti91V → A in AAV85854 (PubMed:15988012).Curated1
Sequence conflicti91V → A in AAH27806 (PubMed:15489334).Curated1
Sequence conflicti376T → S in AAH31705 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0270881 – 6MFPGLA → MESVGAAGGSEAGGGVRVGA SAPPGCFRAWP in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY682914 mRNA Translation: AAV85854.1
AK028885 mRNA Translation: BAC26172.1
AK033990 mRNA Translation: BAC28540.1
AK035541 mRNA Translation: BAC29097.1
AK082853 mRNA Translation: BAC38654.1
BC027806 mRNA Translation: AAH27806.1
BC026565 mRNA Translation: AAH26565.1
BC031705 mRNA Translation: AAH31705.1
BC055773 mRNA Translation: AAH55773.1
BC078440 mRNA Translation: AAH78440.1
AF263460 mRNA Translation: AAF73055.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39103.1 [Q5IRJ6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001297558.1, NM_001310629.1
NP_848766.2, NM_178651.4 [Q5IRJ6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000162372; ENSMUSP00000124047; ENSMUSG00000029221 [Q5IRJ6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
109108

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:109108

UCSC genome browser

More...
UCSCi
uc008xpt.1 mouse [Q5IRJ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY682914 mRNA Translation: AAV85854.1
AK028885 mRNA Translation: BAC26172.1
AK033990 mRNA Translation: BAC28540.1
AK035541 mRNA Translation: BAC29097.1
AK082853 mRNA Translation: BAC38654.1
BC027806 mRNA Translation: AAH27806.1
BC026565 mRNA Translation: AAH26565.1
BC031705 mRNA Translation: AAH31705.1
BC055773 mRNA Translation: AAH55773.1
BC078440 mRNA Translation: AAH78440.1
AF263460 mRNA Translation: AAF73055.1
CCDSiCCDS39103.1 [Q5IRJ6-1]
RefSeqiNP_001297558.1, NM_001310629.1
NP_848766.2, NM_178651.4 [Q5IRJ6-1]

3D structure databases

SMRiQ5IRJ6
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000124047

PTM databases

iPTMnetiQ5IRJ6
PhosphoSitePlusiQ5IRJ6

Proteomic databases

EPDiQ5IRJ6
PaxDbiQ5IRJ6
PeptideAtlasiQ5IRJ6
PRIDEiQ5IRJ6

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1339 147 antibodies

Genome annotation databases

EnsembliENSMUST00000162372; ENSMUSP00000124047; ENSMUSG00000029221 [Q5IRJ6-1]
GeneIDi109108
KEGGimmu:109108
UCSCiuc008xpt.1 mouse [Q5IRJ6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10463
MGIiMGI:1923690 Slc30a9

Phylogenomic databases

eggNOGiKOG2802 Eukaryota
COG0053 LUCA
GeneTreeiENSGT00390000008346
InParanoidiQ5IRJ6
KOiK14696
OrthoDBi667718at2759
PhylomeDBiQ5IRJ6
TreeFamiTF314526

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
109108 5 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc30a9 mouse

Protein Ontology

More...
PROi
PR:Q5IRJ6
RNActiQ5IRJ6 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029221 Expressed in cumulus cell and 285 other tissues
GenevisibleiQ5IRJ6 MM

Family and domain databases

Gene3Di1.20.1510.10, 1 hit
3.90.530.10, 1 hit
InterProiView protein in InterPro
IPR002524 Cation_efflux
IPR027469 Cation_efflux_TMD_sf
IPR009061 DNA-bd_dom_put_sf
IPR040177 SLC30A9
IPR037129 XPA_sf
PANTHERiPTHR13414 PTHR13414, 1 hit
PfamiView protein in Pfam
PF01545 Cation_efflux, 1 hit
SUPFAMiSSF161111 SSF161111, 1 hit
SSF46955 SSF46955, 1 hit
TIGRFAMsiTIGR01297 CDF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZNT9_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5IRJ6
Secondary accession number(s): Q66L46
, Q7TNE9, Q8BGX8, Q8BUR1, Q8BZP2, Q8K2E0, Q8K376, Q8R0P1, Q9JK46
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: June 17, 2020
This is version 107 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again