Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (08 May 2019)
Sequence version 2 (05 Feb 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

SH3 domain-containing protein 19

Gene

SH3D19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. May be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1. Plays a role in the regulation of cell morphology and cytoskeletal organization.3 Publications

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-432722 Golgi Associated Vesicle Biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3 domain-containing protein 19
Alternative name(s):
ADAM-binding protein Eve-1
EEN-binding protein
Short name:
EBP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH3D19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30418 SH3D19

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608674 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5HYK7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000109686

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162403244

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH3D19

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166977688

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003181971 – 790SH3 domain-containing protein 19Add BLAST790

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei65PhosphoserineBy similarity1
Modified residuei369PhosphoserineBy similarity1
Modified residuei762PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5HYK7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5HYK7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5HYK7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5HYK7

PeptideAtlas

More...
PeptideAtlasi
Q5HYK7

PRoteomics IDEntifications database

More...
PRIDEi
Q5HYK7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62944
62945 [Q5HYK7-2]
62946 [Q5HYK7-3]
62947 [Q5HYK7-4]
62948 [Q5HYK7-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5HYK7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5HYK7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in heart, skeletal muscle, kidney, liver, placenta, small intestine and lung. Expressed at low levels in colon, thymus, spleen and leukocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000109686 Expressed in 198 organ(s), highest expression level in tendon of biceps brachii

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5HYK7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5HYK7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016424
HPA058562

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ADAM12. Isoform 4 and isoform 5 (but not isoform 1 and isoform 2) interact with ADAM9, ADAM10, ADAM15 and ADAM17. Interacts with SH3GL1 SH3 domain. Interacts via SH3 3 and SH3 4 or SH3 4 and SH3 5 domains with SOS2. Probably forms a trimeric complex with SH3GL1 and SOS2. Interacts with SH3YL1 (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SH3YL1Q96HL84EBI-14699032,EBI-722667

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127448, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q5HYK7, 7 interactors

Molecular INTeraction database

More...
MINTi
Q5HYK7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302913

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5HYK7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini415 – 477SH3 1PROSITE-ProRule annotationAdd BLAST63
Domaini495 – 554SH3 2PROSITE-ProRule annotationAdd BLAST60
Domaini571 – 630SH3 3PROSITE-ProRule annotationAdd BLAST60
Domaini661 – 720SH3 4PROSITE-ProRule annotationAdd BLAST60
Domaini730 – 789SH3 5PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni342 – 358Interaction with SH3GL11 PublicationAdd BLAST17

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi86 – 350Pro-richAdd BLAST265

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPNQ Eukaryota
ENOG4111GFH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155694

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5HYK7

Database of Orthologous Groups

More...
OrthoDBi
288421at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5HYK7

TreeFam database of animal gene trees

More...
TreeFami
TF330850

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11814 SH3_Eve1_1, 1 hit
cd11816 SH3_Eve1_3, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035834 Eve1_SH3_1
IPR035835 Eve1_SH3_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 2 hits
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5HYK7-1) [UniParc]FASTAAdd to basket
Also known as: Eve-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNIMNTEQSQ NSIVSRIKVF EGQTNIETSG LPKKPEITPR SLPPKPTVSS
60 70 80 90 100
GKPSVAPKPA ANRASGEWDS GTENRLKVTS KEGLTPYPPL QEAGSIPVTK
110 120 130 140 150
PELPKKPNPG LIRSVNPEIP GRGPLAESSD SGKKVPTPAP RPLLLKKSVS
160 170 180 190 200
SENPTYPSAP LKPVTVPPRL AGASQAKAYK SLGEGPPANP PVPVLQSKPL
210 220 230 240 250
VDIDLISFDD DVLPTPSGNL AEESVGSEMV LDPFQLPAKT EPIKERAVQP
260 270 280 290 300
APTRKPTVIR IPAKPGKCLH EDPQSPPPLP AEKPIGNTFS TVSGKLSNVE
310 320 330 340 350
RTRNLESNHP GQTGGFVRVP PRLPPRPVNG KTIPTQQPPT KVPPERPPPP
360 370 380 390 400
KLSATRRSNK KLPFNRSSSD MDLQKKQSNL ATGLSKAKSQ VFKNQDPVLP
410 420 430 440 450
PRPKPGHPLY SKYMLSVPHG IANEDIVSQN PGELSCKRGD VLVMLKQTEN
460 470 480 490 500
NYLECQKGED TGRVHLSQMK IITPLDEHLR SRPNDPSHAQ KPVDSGAPHA
510 520 530 540 550
VVLHDFPAEQ VDDLNLTSGE IVYLLEKIDT DWYRGNCRNQ IGIFPANYVK
560 570 580 590 600
VIIDIPEGGN GKRECVSSHC VKGSRCVARF EYIGEQKDEL SFSEGEIIIL
610 620 630 640 650
KEYVNEEWAR GEVRGRTGIF PLNFVEPVED YPTSGANVLS TKVPLKTKKE
660 670 680 690 700
DSGSNSQVNS LPAEWCEALH SFTAETSDDL SFKRGDRIQI LERLDSDWCR
710 720 730 740 750
GRLQDREGIF PAVFVRPCPA EAKSMLAIVP KGRKAKALYD FRGENEDELS
760 770 780 790
FKAGDIITEL ESVDDDWMSG ELMGKSGIFP KNYIQFLQIS
Length:790
Mass (Da):86,525
Last modified:February 5, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFA860FB41FE8CDD5
GO
Isoform 2 (identifier: Q5HYK7-2) [UniParc]FASTAAdd to basket
Also known as: Eve-1b

The sequence of this isoform differs from the canonical sequence as follows:
     415-437: Missing.

Show »
Length:767
Mass (Da):84,136
Checksum:i9DC52412DD810D43
GO
Isoform 3 (identifier: Q5HYK7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-268: DPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKC → G
     415-437: Missing.

Show »
Length:731
Mass (Da):80,131
Checksum:i34B191C247F3D367
GO
Isoform 4 (identifier: Q5HYK7-4) [UniParc]FASTAAdd to basket
Also known as: Eve-1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.

Show »
Length:420
Mass (Da):47,056
Checksum:iC49CE5F2A5DCAF1C
GO
Isoform 5 (identifier: Q5HYK7-5) [UniParc]FASTAAdd to basket
Also known as: Eve-1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.
     415-437: Missing.

Show »
Length:397
Mass (Da):44,667
Checksum:i813BAA810E48B27B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQE4A0A0U1RQE4_HUMAN
SH3 domain-containing protein 19
SH3D19
1,047Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQN2A0A0U1RQN2_HUMAN
SH3 domain-containing protein 19
SH3D19
233Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C1M0A0A494C1M0_HUMAN
SH3 domain-containing protein 19
SH3D19
1,011Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI08891 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI08892 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI08893 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI08894 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAF83714 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI46052 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1M → V in CAI46052 (PubMed:17974005).Curated1
Sequence conflicti264K → R in CAI46052 (PubMed:17974005).Curated1
Sequence conflicti267K → E in CAI46052 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0311821 – 370Missing in isoform 4 and isoform 5. CuratedAdd BLAST370
Alternative sequenceiVSP_031183232 – 268DPFQL…KPGKC → G in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_031184415 – 437Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK291025 mRNA Translation: BAF83714.1 Different initiation.
AK294476 mRNA Translation: BAH11782.1
AL133047 mRNA Translation: CAB61374.1
BX647422 mRNA Translation: CAI46052.1 Different initiation.
AC095055 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04986.1
BC032468 mRNA Translation: AAH32468.1
BC045742 mRNA Translation: AAH45742.1
BC085613 mRNA Translation: AAH85613.2
BC108890 mRNA Translation: AAI08891.1 Different initiation.
BC108891 mRNA Translation: AAI08892.1 Different initiation.
BC108892 mRNA Translation: AAI08893.1 Different initiation.
BC108893 mRNA Translation: AAI08894.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34077.2 [Q5HYK7-1]
CCDS47143.1 [Q5HYK7-3]
CCDS47144.1 [Q5HYK7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001009555.3, NM_001009555.3 [Q5HYK7-1]
NP_001122395.1, NM_001128923.1 [Q5HYK7-2]
NP_001122396.1, NM_001128924.1 [Q5HYK7-3]
NP_001230278.1, NM_001243349.1 [Q5HYK7-2]
XP_005262824.1, XM_005262767.2 [Q5HYK7-1]
XP_011529948.1, XM_011531646.1 [Q5HYK7-1]
XP_011529951.1, XM_011531649.1
XP_016863268.1, XM_017007779.1 [Q5HYK7-3]
XP_016863270.1, XM_017007781.1 [Q5HYK7-1]
XP_016863271.1, XM_017007782.1 [Q5HYK7-2]
XP_016863272.1, XM_017007783.1 [Q5HYK7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304527; ENSP00000302913; ENSG00000109686 [Q5HYK7-1]
ENST00000409252; ENSP00000386848; ENSG00000109686 [Q5HYK7-1]
ENST00000409598; ENSP00000387030; ENSG00000109686 [Q5HYK7-2]
ENST00000427414; ENSP00000415694; ENSG00000109686 [Q5HYK7-3]
ENST00000514152; ENSP00000423449; ENSG00000109686 [Q5HYK7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
152503

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:152503

UCSC genome browser

More...
UCSCi
uc003imc.3 human [Q5HYK7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291025 mRNA Translation: BAF83714.1 Different initiation.
AK294476 mRNA Translation: BAH11782.1
AL133047 mRNA Translation: CAB61374.1
BX647422 mRNA Translation: CAI46052.1 Different initiation.
AC095055 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04986.1
BC032468 mRNA Translation: AAH32468.1
BC045742 mRNA Translation: AAH45742.1
BC085613 mRNA Translation: AAH85613.2
BC108890 mRNA Translation: AAI08891.1 Different initiation.
BC108891 mRNA Translation: AAI08892.1 Different initiation.
BC108892 mRNA Translation: AAI08893.1 Different initiation.
BC108893 mRNA Translation: AAI08894.1 Different initiation.
CCDSiCCDS34077.2 [Q5HYK7-1]
CCDS47143.1 [Q5HYK7-3]
CCDS47144.1 [Q5HYK7-2]
RefSeqiNP_001009555.3, NM_001009555.3 [Q5HYK7-1]
NP_001122395.1, NM_001128923.1 [Q5HYK7-2]
NP_001122396.1, NM_001128924.1 [Q5HYK7-3]
NP_001230278.1, NM_001243349.1 [Q5HYK7-2]
XP_005262824.1, XM_005262767.2 [Q5HYK7-1]
XP_011529948.1, XM_011531646.1 [Q5HYK7-1]
XP_011529951.1, XM_011531649.1
XP_016863268.1, XM_017007779.1 [Q5HYK7-3]
XP_016863270.1, XM_017007781.1 [Q5HYK7-1]
XP_016863271.1, XM_017007782.1 [Q5HYK7-2]
XP_016863272.1, XM_017007783.1 [Q5HYK7-2]

3D structure databases

SMRiQ5HYK7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127448, 10 interactors
IntActiQ5HYK7, 7 interactors
MINTiQ5HYK7
STRINGi9606.ENSP00000302913

PTM databases

iPTMnetiQ5HYK7
PhosphoSitePlusiQ5HYK7

Polymorphism and mutation databases

BioMutaiSH3D19
DMDMi166977688

Proteomic databases

EPDiQ5HYK7
jPOSTiQ5HYK7
MaxQBiQ5HYK7
PaxDbiQ5HYK7
PeptideAtlasiQ5HYK7
PRIDEiQ5HYK7
ProteomicsDBi62944
62945 [Q5HYK7-2]
62946 [Q5HYK7-3]
62947 [Q5HYK7-4]
62948 [Q5HYK7-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304527; ENSP00000302913; ENSG00000109686 [Q5HYK7-1]
ENST00000409252; ENSP00000386848; ENSG00000109686 [Q5HYK7-1]
ENST00000409598; ENSP00000387030; ENSG00000109686 [Q5HYK7-2]
ENST00000427414; ENSP00000415694; ENSG00000109686 [Q5HYK7-3]
ENST00000514152; ENSP00000423449; ENSG00000109686 [Q5HYK7-2]
GeneIDi152503
KEGGihsa:152503
UCSCiuc003imc.3 human [Q5HYK7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
152503

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH3D19
HGNCiHGNC:30418 SH3D19
HPAiHPA016424
HPA058562
MIMi608674 gene
neXtProtiNX_Q5HYK7
OpenTargetsiENSG00000109686
PharmGKBiPA162403244

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IPNQ Eukaryota
ENOG4111GFH LUCA
GeneTreeiENSGT00940000155694
InParanoidiQ5HYK7
OrthoDBi288421at2759
PhylomeDBiQ5HYK7
TreeFamiTF330850

Enzyme and pathway databases

ReactomeiR-HSA-432722 Golgi Associated Vesicle Biogenesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH3D19 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
152503

Protein Ontology

More...
PROi
PR:Q5HYK7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000109686 Expressed in 198 organ(s), highest expression level in tendon of biceps brachii
ExpressionAtlasiQ5HYK7 baseline and differential
GenevisibleiQ5HYK7 HS

Family and domain databases

CDDicd11814 SH3_Eve1_1, 1 hit
cd11816 SH3_Eve1_3, 1 hit
InterProiView protein in InterPro
IPR035834 Eve1_SH3_1
IPR035835 Eve1_SH3_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 2 hits
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 5 hits
SUPFAMiSSF50044 SSF50044, 5 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH319_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5HYK7
Secondary accession number(s): B7Z296
, Q08EK1, Q32N10, Q5U3B8, Q86XB3, Q8N5E7, Q9UFC8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: May 8, 2019
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again