Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (18 Sep 2019)
Sequence version 1 (01 Mar 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable E3 ubiquitin-protein ligase HERC4

Gene

HERC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.26

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1025Glycyl thioester intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell differentiation Source: UniProtKB-KW
  • spermatogenesis Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processDifferentiation, Spermatogenesis, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase HERC4 (EC:2.3.2.26)
Alternative name(s):
HECT domain and RCC1-like domain-containing protein 4
HECT-type E3 ubiquitin transferase HERC4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HERC4
Synonyms:KIAA1593
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24521 HERC4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609248 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5GLZ8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26091

Open Targets

More...
OpenTargetsi
ENSG00000148634

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134949021

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HERC4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74707832

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002782161 – 1057Probable E3 ubiquitin-protein ligase HERC4Add BLAST1057

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5GLZ8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5GLZ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5GLZ8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5GLZ8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5GLZ8

PeptideAtlas

More...
PeptideAtlasi
Q5GLZ8

PRoteomics IDEntifications database

More...
PRIDEi
Q5GLZ8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62837 [Q5GLZ8-1]
62838 [Q5GLZ8-2]
62839 [Q5GLZ8-3]
62840 [Q5GLZ8-4]
62841 [Q5GLZ8-5]
62842 [Q5GLZ8-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5GLZ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5GLZ8

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q5GLZ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and testis and detected in heart and placenta.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148634 Expressed in 215 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5GLZ8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5GLZ8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045453
HPA070301

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117542, 46 interactors

Protein interaction database and analysis system

More...
IntActi
Q5GLZ8, 20 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378624

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5GLZ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 51RCC1 1Add BLAST51
Repeati52 – 101RCC1 2Add BLAST50
Repeati102 – 154RCC1 3Add BLAST53
Repeati156 – 207RCC1 4Add BLAST52
Repeati208 – 259RCC1 5Add BLAST52
Repeati261 – 311RCC1 6Add BLAST51
Repeati313 – 368RCC1 7Add BLAST56
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini730 – 1057HECTPROSITE-ProRule annotationAdd BLAST328

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0941 Eukaryota
COG5021 LUCA
COG5184 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158924

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000208452

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5GLZ8

KEGG Orthology (KO)

More...
KOi
K10615

Database of Orthologous Groups

More...
OrthoDBi
1062377at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5GLZ8

TreeFam database of animal gene trees

More...
TreeFami
TF315189

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00078 HECTc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR009091 RCC1/BLIP-II
IPR000408 Reg_chr_condens

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00632 HECT, 1 hit
PF00415 RCC1, 7 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00633 RCCNDNSATION

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00119 HECTc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50985 SSF50985, 1 hit
SSF56204 SSF56204, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50237 HECT, 1 hit
PS00626 RCC1_2, 3 hits
PS50012 RCC1_3, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5GLZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLCWGNASFG QLGLGGIDEE IVLEPRKSDF FINKRVRDVG CGLRHTVFVL
60 70 80 90 100
DDGTVYTCGC NDLGQLGHEK SRKKPEQVVA LDAQNIVAVS CGEAHTLALN
110 120 130 140 150
DKGQVYAWGL DSDGQLGLVG SEECIRVPRN IKSLSDIQIV QVACGYYHSL
160 170 180 190 200
ALSKASEVFC WGQNKYGQLG LGTDCKKQTS PQLLKSLLGI PFMQVAAGGA
210 220 230 240 250
HSFVLTLSGA IFGWGRNKFG QLGLNDENDR YVPNLLKSLR SQKIVYICCG
260 270 280 290 300
EDHTAALTKE GGVFTFGAGG YGQLGHNSTS HEINPRKVFE LMGSIVTEIA
310 320 330 340 350
CGRQHTSAFV PSSGRIYSFG LGGNGQLGTG STSNRKSPFT VKGNWYPYNG
360 370 380 390 400
QCLPDIDSEE YFCVKRIFSG GDQSFSHYSS PQNCGPPDDF RCPNPTKQIW
410 420 430 440 450
TVNEALIQKW LSYPSGRFPV EIANEIDGTF SSSGCLNGSF LAVSNDDHYR
460 470 480 490 500
TGTRFSGVDM NAARLLFHKL IQPDHPQISQ QVAASLEKNL IPKLTSSLPD
510 520 530 540 550
VEALRFYLTL PECPLMSDSN NFTTIAIPFG TALVNLEKAP LKVLENWWSV
560 570 580 590 600
LEPPLFLKIV ELFKEVVVHL LKLYKIGIPP SERRIFNSFL HTALKVLEIL
610 620 630 640 650
HRVNEKMGQI IQYDKFYIHE VQELIDIRND YINWVQQQAY GMDVNHGLTE
660 670 680 690 700
LADIPVTICT YPFVFDAQAK TTLLQTDAVL QMQMAIDQAH RQNVSSLFLP
710 720 730 740 750
VIESVNPCLI LVVRRENIVG DAMEVLRKTK NIDYKKPLKV IFVGEDAVDA
760 770 780 790 800
GGVRKEFFLL IMRELLDPKY GMFRYYEDSR LIWFSDKTFE DSDLFHLIGV
810 820 830 840 850
ICGLAIYNCT IVDLHFPLAL YKKLLKKKPS LDDLKELMPD VGRSMQQLLD
860 870 880 890 900
YPEDDIEETF CLNFTITVEN FGATEVKELV LNGADTAVNK QNRQEFVDAY
910 920 930 940 950
VDYIFNKSVA SLFDAFHAGF HKVCGGKVLL LFQPNELQAM VIGNTNYDWK
960 970 980 990 1000
ELEKNTEYKG EYWAEHPTIK IFWEVFHELP LEKKKQFLLF LTGSDRIPIL
1010 1020 1030 1040 1050
GMKSLKLVIQ STGGGEEYLP VSHTCFNLLD LPKYTEKETL RSKLIQAIDH

NEGFSLI
Length:1,057
Mass (Da):118,563
Last modified:March 1, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7F06DA755A68243A
GO
Isoform 2 (identifier: Q5GLZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     643-650: Missing.

Show »
Length:1,049
Mass (Da):117,697
Checksum:i0B1444455A28BDEA
GO
Isoform 3 (identifier: Q5GLZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-865: Missing.

Show »
Length:979
Mass (Da):109,585
Checksum:i5EA9F00BE89BE5BD
GO
Isoform 4 (identifier: Q5GLZ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-110: QVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGL → FRSCFPGRSAMAPSRLTATSASQVQAILLPQPPE
     111-1057: Missing.

Show »
Length:110
Mass (Da):12,026
Checksum:i74455E07E7BB358B
GO
Isoform 5 (identifier: Q5GLZ8-5) [UniParc]FASTAAdd to basket
Also known as: 2

The sequence of this isoform differs from the canonical sequence as follows:
     77-117: QVVALDAQNI...WGLDSDGQLG → ILKVCQISRL...GDRINMANWV
     118-1057: Missing.

Show »
Length:117
Mass (Da):13,215
Checksum:i3B3FE6EB8C3B9947
GO
Isoform 6 (identifier: Q5GLZ8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.
     111-128: DSDGQLGLVGSEECIRVP → MCVDSLVRICSGLSYGRI

Note: No experimental confirmation available.
Show »
Length:947
Mass (Da):106,715
Checksum:i3088CCEB250356B9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RCL5D6RCL5_HUMAN
Probable E3 ubiquitin-protein ligas...
HERC4
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6K7H0Y6K7_HUMAN
Probable E3 ubiquitin-protein ligas...
HERC4
399Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFK9D6RFK9_HUMAN
Probable E3 ubiquitin-protein ligas...
HERC4
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13419 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1032P → S in AAV66579 (PubMed:15676274).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0231721 – 110Missing in isoform 6. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_02317377 – 117QVVAL…DGQLG → ILKVCQISRLYRLLVVTIIH LHFLKQVKSSVGDRINMANW V in isoform 5. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_02317477 – 110QVVAL…YAWGL → FRSCFPGRSAMAPSRLTATS ASQVQAILLPQPPE in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_023175111 – 1057Missing in isoform 4. 1 PublicationAdd BLAST947
Alternative sequenceiVSP_039551111 – 128DSDGQ…CIRVP → MCVDSLVRICSGLSYGRI in isoform 6. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023176118 – 1057Missing in isoform 5. 2 PublicationsAdd BLAST940
Alternative sequenceiVSP_023178643 – 650Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_023179788 – 865Missing in isoform 3. 1 PublicationAdd BLAST78

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY221963 mRNA Translation: AAO65480.1
AY650032 mRNA Translation: AAV66578.1
AY650033 mRNA Translation: AAV66579.1
AY650034 mRNA Translation: AAV66580.1
AB046813 mRNA Translation: BAB13419.1 Different initiation.
AC024258 Genomic DNA No translation available.
AL133551 Genomic DNA No translation available.
AL356741 Genomic DNA No translation available.
BC039600 mRNA Translation: AAH39600.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41533.1 [Q5GLZ8-1]
CCDS60541.1 [Q5GLZ8-3]
CCDS60542.1 [Q5GLZ8-4]
CCDS7274.1 [Q5GLZ8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001265114.1, NM_001278185.1 [Q5GLZ8-3]
NP_001265115.1, NM_001278186.1
NP_001265116.1, NM_001278187.1 [Q5GLZ8-4]
NP_056416.2, NM_015601.3 [Q5GLZ8-2]
NP_071362.1, NM_022079.2 [Q5GLZ8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000277817; ENSP00000277817; ENSG00000148634 [Q5GLZ8-6]
ENST00000373700; ENSP00000362804; ENSG00000148634 [Q5GLZ8-2]
ENST00000395198; ENSP00000378624; ENSG00000148634 [Q5GLZ8-1]
ENST00000412272; ENSP00000416504; ENSG00000148634 [Q5GLZ8-3]
ENST00000473533; ENSP00000423671; ENSG00000148634 [Q5GLZ8-5]
ENST00000492996; ENSP00000422383; ENSG00000148634 [Q5GLZ8-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26091

UCSC genome browser

More...
UCSCi
uc001jng.5 human [Q5GLZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221963 mRNA Translation: AAO65480.1
AY650032 mRNA Translation: AAV66578.1
AY650033 mRNA Translation: AAV66579.1
AY650034 mRNA Translation: AAV66580.1
AB046813 mRNA Translation: BAB13419.1 Different initiation.
AC024258 Genomic DNA No translation available.
AL133551 Genomic DNA No translation available.
AL356741 Genomic DNA No translation available.
BC039600 mRNA Translation: AAH39600.1
CCDSiCCDS41533.1 [Q5GLZ8-1]
CCDS60541.1 [Q5GLZ8-3]
CCDS60542.1 [Q5GLZ8-4]
CCDS7274.1 [Q5GLZ8-2]
RefSeqiNP_001265114.1, NM_001278185.1 [Q5GLZ8-3]
NP_001265115.1, NM_001278186.1
NP_001265116.1, NM_001278187.1 [Q5GLZ8-4]
NP_056416.2, NM_015601.3 [Q5GLZ8-2]
NP_071362.1, NM_022079.2 [Q5GLZ8-1]

3D structure databases

SMRiQ5GLZ8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117542, 46 interactors
IntActiQ5GLZ8, 20 interactors
STRINGi9606.ENSP00000378624

PTM databases

iPTMnetiQ5GLZ8
PhosphoSitePlusiQ5GLZ8
SwissPalmiQ5GLZ8

Polymorphism and mutation databases

BioMutaiHERC4
DMDMi74707832

Proteomic databases

EPDiQ5GLZ8
jPOSTiQ5GLZ8
MassIVEiQ5GLZ8
MaxQBiQ5GLZ8
PaxDbiQ5GLZ8
PeptideAtlasiQ5GLZ8
PRIDEiQ5GLZ8
ProteomicsDBi62837 [Q5GLZ8-1]
62838 [Q5GLZ8-2]
62839 [Q5GLZ8-3]
62840 [Q5GLZ8-4]
62841 [Q5GLZ8-5]
62842 [Q5GLZ8-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
26091
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277817; ENSP00000277817; ENSG00000148634 [Q5GLZ8-6]
ENST00000373700; ENSP00000362804; ENSG00000148634 [Q5GLZ8-2]
ENST00000395198; ENSP00000378624; ENSG00000148634 [Q5GLZ8-1]
ENST00000412272; ENSP00000416504; ENSG00000148634 [Q5GLZ8-3]
ENST00000473533; ENSP00000423671; ENSG00000148634 [Q5GLZ8-5]
ENST00000492996; ENSP00000422383; ENSG00000148634 [Q5GLZ8-4]
GeneIDi26091
KEGGihsa:26091
UCSCiuc001jng.5 human [Q5GLZ8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26091
DisGeNETi26091

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HERC4
HGNCiHGNC:24521 HERC4
HPAiHPA045453
HPA070301
MIMi609248 gene
neXtProtiNX_Q5GLZ8
OpenTargetsiENSG00000148634
PharmGKBiPA134949021

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0941 Eukaryota
COG5021 LUCA
COG5184 LUCA
GeneTreeiENSGT00940000158924
HOGENOMiHOG000208452
InParanoidiQ5GLZ8
KOiK10615
OrthoDBi1062377at2759
PhylomeDBiQ5GLZ8
TreeFamiTF315189

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HERC4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26091

Pharos

More...
Pharosi
Q5GLZ8

Protein Ontology

More...
PROi
PR:Q5GLZ8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000148634 Expressed in 215 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ5GLZ8 baseline and differential
GenevisibleiQ5GLZ8 HS

Family and domain databases

CDDicd00078 HECTc, 1 hit
Gene3Di2.130.10.30, 2 hits
InterProiView protein in InterPro
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR009091 RCC1/BLIP-II
IPR000408 Reg_chr_condens
PfamiView protein in Pfam
PF00632 HECT, 1 hit
PF00415 RCC1, 7 hits
PRINTSiPR00633 RCCNDNSATION
SMARTiView protein in SMART
SM00119 HECTc, 1 hit
SUPFAMiSSF50985 SSF50985, 1 hit
SSF56204 SSF56204, 1 hit
PROSITEiView protein in PROSITE
PS50237 HECT, 1 hit
PS00626 RCC1_2, 3 hits
PS50012 RCC1_3, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHERC4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5GLZ8
Secondary accession number(s): Q5GC98
, Q5GC99, Q5GCA0, Q8IXP9, Q9HCH9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: March 1, 2005
Last modified: September 18, 2019
This is version 129 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again