Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (17 Jun 2020)
Sequence version 2 (05 Jul 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DNA annealing helicase and endonuclease ZRANB3

Gene

ZRANB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA annealing helicase and endonuclease required to maintain genome stability at stalled or collapsed replication forks by facilitating fork restart and limiting inappropriate recombination that could occur during template switching events (PubMed:21078962, PubMed:22704558, PubMed:22705370, PubMed:22759634, PubMed:26884333). Recruited to the sites of stalled DNA replication by polyubiquitinated PCNA and acts as a structure-specific endonuclease that cleaves the replication fork D-loop intermediate, generating an accessible 3'-OH group in the template of the leading strand, which is amenable to extension by DNA polymerase (PubMed:22759634). In addition to endonuclease activity, also catalyzes the fork regression via annealing helicase activity in order to prevent disintegration of the replication fork and the formation of double-strand breaks (PubMed:22705370, PubMed:22704558).5 Publications

Miscellaneous

In contrast to classical helicases that unwing DNA, annealing helicases rewind it.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi59 – 66ATPPROSITE-ProRule annotation8
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri621 – 650RanBP2-typePROSITE-ProRule annotationAdd BLAST30

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionEndonuclease, Helicase, Hydrolase, Multifunctional enzyme, Nuclease
Biological processDNA damage, DNA repair
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA annealing helicase and endonuclease ZRANB3Curated
Alternative name(s):
Annealing helicase 21 Publication
Short name:
AH21 Publication
Zinc finger Ran-binding domain-containing protein 3Curated
Including the following 2 domains:
DNA annealing helicase ZRANB3Curated (EC:3.6.4.-2 Publications)
Endonuclease ZRANB3Curated (EC:3.1.-.-1 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZRANB31 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000121988.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25249 ZRANB3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615655 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5FWF4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi65K → R: Abolishes ATPase activity. Abolishes endonuclease activity; when associated with A-1021. 1 Publication1
Mutagenesisi157 – 158DE → AA: Abolishes fork regression activity. 1 Publication2
Mutagenesisi163K → D: Loss of DNA-dependent ATPase activity. 1 Publication1
Mutagenesisi519Q → A: Abolishes interaction with PCNA; when associated with A-522; 525-A-A-526 and A-1075. Abolishes interaction with PCNA; when associated with A-525. 3 Publications1
Mutagenesisi522I → A: Abolishes interaction with PCNA; when associated with A-519; 525-A-A-526 and A-1075. 1 Publication1
Mutagenesisi525 – 526FF → AA: Abolishes interaction with PCNA; when associated with A-519; A-522 and A-1075. 2 Publications2
Mutagenesisi525F → A: Abolishes interaction with PCNA; when associated with A-519. 1 Publication1
Mutagenesisi625W → A: Abolishes interaction with 'Lys-63'-linked polyubiquitin. 1 Publication1
Mutagenesisi631 – 632TY → AA: Abolishes interaction with 'Lys-63'-linked polyubiquitin. 2
Mutagenesisi631T → A: Impaired interaction with 'Lys-63'-linked polyubiquitin. 2 Publications1
Mutagenesisi632Y → A: Abolishes interaction with 'Lys-63'-linked polyubiquitin. 1 Publication1
Mutagenesisi634N → A: Abolishes interaction with 'Lys-63'-linked polyubiquitin. 1 Publication1
Mutagenesisi643M → A: Impaired interaction with polyubiquitin. 1 Publication1
Mutagenesisi762 – 764LDI → AAA: Loss of DNA-binding, DNA-dependent ATPase and nuclease activities. 1 Publication3
Mutagenesisi792 – 794WSS → AAA: Loss of DNA-dependent ATPase activity. 1 Publication3
Mutagenesisi1021H → A: Does not affect endonuclease. Abolishes endonuclease activity; when associated with R-65. 1 Publication1
Mutagenesisi1075F → A: Abolishes interaction with PCNA; when associated with A-519; A-522 and 525-A-A-526. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
84083

Open Targets

More...
OpenTargetsi
ENSG00000121988

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134871612

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5FWF4 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZRANB3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74741477

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002781821 – 1079DNA annealing helicase and endonuclease ZRANB3Add BLAST1079

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei569PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5FWF4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5FWF4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5FWF4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5FWF4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5FWF4

PeptideAtlas

More...
PeptideAtlasi
Q5FWF4

PRoteomics IDEntifications database

More...
PRIDEi
Q5FWF4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19263
62811 [Q5FWF4-1]
62812 [Q5FWF4-2]
62813 [Q5FWF4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5FWF4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5FWF4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000121988 Expressed in intestine and 145 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5FWF4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5FWF4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000121988 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via PIP-box and RanBP2-type zinc finger) with PCNA (when PCNA is polyubiquitinated via 'Lys-63'-linked polyubiquitin).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123877, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q5FWF4, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000264159

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5FWF4 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11079
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5FWF4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini46 – 208Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST163
Domaini325 – 481Helicase C-terminalPROSITE-ProRule annotationAdd BLAST157
Domaini1011 – 1051HNHAdd BLAST41

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni46 – 481DNA annealing helicase activityAdd BLAST436
Regioni1011 – 1079Endonuclease activityAdd BLAST69

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi157 – 160DEAH box4
Motifi519 – 526PIP-box8
Motifi1074 – 1078APIM motif5

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PIP-box mediates the interaction with PCNA, while the RanBP2-type zinc finger mediates binding to 'Lys-63'-linked polyubiquitin (PubMed:22704558, PubMed:22705370 and PubMed:22759634).3 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri621 – 650RanBP2-typePROSITE-ProRule annotationAdd BLAST30

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1000 Eukaryota
COG0553 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158559

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004251_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5FWF4

Identification of Orthologs from Complete Genome Data

More...
OMAi
CTVCHRE

Database of Orthologous Groups

More...
OrthoDBi
1082831at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5FWF4

TreeFam database of animal gene trees

More...
TreeFami
TF354227

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00085 HNHc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10810, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR002711 HNH
IPR003615 HNH_nuc
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00271 Helicase_C, 1 hit
PF01844 HNH, 1 hit
PF00176 SNF2_N, 1 hit
PF00641 zf-RanBP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00487 DEXDc, 1 hit
SM00490 HELICc, 1 hit
SM00507 HNHc, 1 hit
SM00547 ZnF_RBZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 2 hits
SSF90209 SSF90209, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01358 ZF_RANBP2_1, 1 hit
PS50199 ZF_RANBP2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5FWF4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRVHNIKKS LTPHISCVTN ESDNLLDFLP DRLRAKLLPF QKDGIIFALK
60 70 80 90 100
RNGRCMVADE MGLGKTIQAI GITYFYKEEW PLLIVVPSSL RYPWTEEIEK
110 120 130 140 150
WIPELSPEEI NVIQNKTDVR RMSTSKVTVL GYGLLTADAK TLIDALNNQN
160 170 180 190 200
FKVVIVDESH YMKSRNATRS RILLPIVQKA RRAILLTGTP ALGRPEELFM
210 220 230 240 250
QIEALFPQKF GRWTDYAKRY CNAHIRYFGK RPQWDCRGAS NLNELHQLLS
260 270 280 290 300
DIMIRRLKTE VLTQLPPKVR QRIPFDLPSA AAKELNTSFE EWEKIMRTPN
310 320 330 340 350
SGAMETVMGL ITRMFKQTAI AKAGAVKDYI KMMLQNDSLK FLVFAHHLSM
360 370 380 390 400
LQACTEAVIE NKTRYIRIDG SVSSSERIHL VNQFQKDPDT RVAILSIQAA
410 420 430 440 450
GQGLTFTAAS HVVFAELYWD PGHIKQAEDR AHRIGQCSSV NIHYLIANGT
460 470 480 490 500
LDTLMWGMLN RKAQVTGSTL NGRKEKIQAE EGDKEKWDFL QFAEAWTPND
510 520 530 540 550
SSEELRKEAL FTHFEKEKQH DIRSFFVPQP KKRQLMTSCD ESKRFREENT
560 570 580 590 600
VVSSDPTKTA ARDIIDYESD VEPETKRLKL AASEDHCSPS EETPSQSKQI
610 620 630 640 650
RTPLVESVQE AKAQLTTPAF PVEGWQCSLC TYINNSELPY CEMCETPQGS
660 670 680 690 700
AVMQIDSLNH IQDKNEKDDS QKDTSKKVQT ISDCEKQALA QSEPGQLADS
710 720 730 740 750
KEETPKIEKE DGLTSQPGNE QWKSSDTLPV YDTLMFCASR NTDRIHIYTK
760 770 780 790 800
DGKQMSCNFI PLDIKLDLWE DLPASFQLKQ YRSLILRFVR EWSSLTAMKQ
810 820 830 840 850
RIIRKSGQLF CSPILALEEI TKQQTKQNCT KRYITKEDVA VASMDKVKNV
860 870 880 890 900
GGHVRLITKE SRPRDPFTKK LLEDGACVPF LNPYTVQADL TVKPSTSKGY
910 920 930 940 950
LQAVDNEGNP LCLRCQQPTC QTKQACKANS WDSRFCSLKC QEEFWIRSNN
960 970 980 990 1000
SYLRAKVFET EHGVCQLCNV NAQELFLRLR DAPKSQRKNL LYATWTSKLP
1010 1020 1030 1040 1050
LEQLNEMIRN PGEGHFWQVD HIKPVYGGGG QCSLDNLQTL CTVCHKERTA
1060 1070
RQAKERSQVR RQSLASKHGS DITRFLVKK
Length:1,079
Mass (Da):123,248
Last modified:July 5, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B65AB9568B15AAE
GO
Isoform 2 (identifier: Q5FWF4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-535: Missing.
     718-719: Missing.
     1077-1079: VKK → ETSKLHESHKVTGAEQGLQVSGLPDSAAPEGGAAHTNDQRRCQRMKQPLTEVQILSHSS

Show »
Length:598
Mass (Da):67,670
Checksum:i567D1E8DFC2E3D9E
GO
Isoform 3 (identifier: Q5FWF4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     718-719: Missing.

Show »
Length:1,077
Mass (Da):123,077
Checksum:i6C4DC8DE47A66A80
GO
Isoform 4 (identifier: Q5FWF4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-642: Missing.
     718-719: Missing.

Show »
Length:435
Mass (Da):49,723
Checksum:i6BFECF747A79E306
GO
Isoform 5 (identifier: Q5FWF4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     403-428: GLTFTAASHVVFAELYWDPGHIKQAE → DLYDKVAWGKRTLVSGLFMECFCFVP
     429-1079: Missing.

Show »
Length:368
Mass (Da):42,179
Checksum:i5D491F23DDE285D4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYN7F5GYN7_HUMAN
DNA annealing helicase and endonucl...
ZRANB3 hCG_1643600
625Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCT9F8WCT9_HUMAN
DNA annealing helicase and endonucl...
ZRANB3
428Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAX93066 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAG54763 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG65387 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence EAX11631 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAX11633 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti366I → T in BAC04536 (PubMed:14702039).Curated1
Sequence conflicti700S → I in BAG65387 (PubMed:14702039).Curated1
Sequence conflicti847V → A in BAG54763 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_030671541E → K. Corresponds to variant dbSNP:rs935615Ensembl.1
Natural variantiVAR_030672546R → Q. Corresponds to variant dbSNP:rs7608121Ensembl.1
Natural variantiVAR_061237637E → V. Corresponds to variant dbSNP:rs59900519Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0441751 – 642Missing in isoform 4. 1 PublicationAdd BLAST642
Alternative sequenceiVSP_0231381 – 535Missing in isoform 2. 1 PublicationAdd BLAST535
Alternative sequenceiVSP_0441761 – 60Missing in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_044177403 – 428GLTFT…IKQAE → DLYDKVAWGKRTLVSGLFME CFCFVP in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_044178429 – 1079Missing in isoform 5. 1 PublicationAdd BLAST651
Alternative sequenceiVSP_023139718 – 719Missing in isoform 2, isoform 3 and isoform 4. 3 Publications2
Alternative sequenceiVSP_0231401077 – 1079VKK → ETSKLHESHKVTGAEQGLQV SGLPDSAAPEGGAAHTNDQR RCQRMKQPLTEVQILSHSS in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136824 mRNA Translation: CAB66758.1
AK095362 mRNA Translation: BAC04536.1
AK131303 mRNA Translation: BAG54763.1 Different initiation.
AK304601 mRNA Translation: BAG65387.1 Different initiation.
BX647838 mRNA No translation available.
AC012450 Genomic DNA No translation available.
AC016742 Genomic DNA No translation available.
AC017031 Genomic DNA Translation: AAX93066.1 Sequence problems.
AC020602 Genomic DNA No translation available.
AC064850 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11631.1 Sequence problems.
CH471058 Genomic DNA Translation: EAX11633.1 Sequence problems.
BC064616 mRNA Translation: AAH64616.1
BC089429 mRNA Translation: AAH89429.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46419.1 [Q5FWF4-1]
CCDS67963.1 [Q5FWF4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001273497.1, NM_001286568.1 [Q5FWF4-3]
NP_115519.2, NM_032143.3 [Q5FWF4-1]
XP_005263866.1, XM_005263809.1 [Q5FWF4-1]
XP_006712851.1, XM_006712788.1 [Q5FWF4-1]
XP_011510260.1, XM_011511958.2 [Q5FWF4-1]
XP_011510262.1, XM_011511960.1 [Q5FWF4-1]
XP_011510265.1, XM_011511963.1 [Q5FWF4-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000264159; ENSP00000264159; ENSG00000121988 [Q5FWF4-1]
ENST00000401392; ENSP00000383979; ENSG00000121988 [Q5FWF4-3]
ENST00000619650; ENSP00000480120; ENSG00000121988 [Q5FWF4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84083

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84083

UCSC genome browser

More...
UCSCi
uc002tul.5 human [Q5FWF4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136824 mRNA Translation: CAB66758.1
AK095362 mRNA Translation: BAC04536.1
AK131303 mRNA Translation: BAG54763.1 Different initiation.
AK304601 mRNA Translation: BAG65387.1 Different initiation.
BX647838 mRNA No translation available.
AC012450 Genomic DNA No translation available.
AC016742 Genomic DNA No translation available.
AC017031 Genomic DNA Translation: AAX93066.1 Sequence problems.
AC020602 Genomic DNA No translation available.
AC064850 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11631.1 Sequence problems.
CH471058 Genomic DNA Translation: EAX11633.1 Sequence problems.
BC064616 mRNA Translation: AAH64616.1
BC089429 mRNA Translation: AAH89429.2
CCDSiCCDS46419.1 [Q5FWF4-1]
CCDS67963.1 [Q5FWF4-3]
RefSeqiNP_001273497.1, NM_001286568.1 [Q5FWF4-3]
NP_115519.2, NM_032143.3 [Q5FWF4-1]
XP_005263866.1, XM_005263809.1 [Q5FWF4-1]
XP_006712851.1, XM_006712788.1 [Q5FWF4-1]
XP_011510260.1, XM_011511958.2 [Q5FWF4-1]
XP_011510262.1, XM_011511960.1 [Q5FWF4-1]
XP_011510265.1, XM_011511963.1 [Q5FWF4-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5MKWX-ray2.00A/B948-1067[»]
5MLOX-ray1.96B/D/F515-529[»]
5MLWX-ray2.45B/D/F1069-1079[»]
5YD8X-ray2.30U/V/W1069-1079[»]
SMRiQ5FWF4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi123877, 16 interactors
IntActiQ5FWF4, 12 interactors
STRINGi9606.ENSP00000264159

PTM databases

iPTMnetiQ5FWF4
PhosphoSitePlusiQ5FWF4

Polymorphism and mutation databases

BioMutaiZRANB3
DMDMi74741477

Proteomic databases

EPDiQ5FWF4
jPOSTiQ5FWF4
MassIVEiQ5FWF4
MaxQBiQ5FWF4
PaxDbiQ5FWF4
PeptideAtlasiQ5FWF4
PRIDEiQ5FWF4
ProteomicsDBi19263
62811 [Q5FWF4-1]
62812 [Q5FWF4-2]
62813 [Q5FWF4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
56175 68 antibodies

The DNASU plasmid repository

More...
DNASUi
84083

Genome annotation databases

EnsembliENST00000264159; ENSP00000264159; ENSG00000121988 [Q5FWF4-1]
ENST00000401392; ENSP00000383979; ENSG00000121988 [Q5FWF4-3]
ENST00000619650; ENSP00000480120; ENSG00000121988 [Q5FWF4-2]
GeneIDi84083
KEGGihsa:84083
UCSCiuc002tul.5 human [Q5FWF4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84083
DisGeNETi84083
EuPathDBiHostDB:ENSG00000121988.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZRANB3
HGNCiHGNC:25249 ZRANB3
HPAiENSG00000121988 Low tissue specificity
MIMi615655 gene
neXtProtiNX_Q5FWF4
OpenTargetsiENSG00000121988
PharmGKBiPA134871612

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1000 Eukaryota
COG0553 LUCA
GeneTreeiENSGT00940000158559
HOGENOMiCLU_004251_0_0_1
InParanoidiQ5FWF4
OMAiCTVCHRE
OrthoDBi1082831at2759
PhylomeDBiQ5FWF4
TreeFamiTF354227

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84083 1 hit in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZRANB3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84083
PharosiQ5FWF4 Tbio

Protein Ontology

More...
PROi
PR:Q5FWF4
RNActiQ5FWF4 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000121988 Expressed in intestine and 145 other tissues
ExpressionAtlasiQ5FWF4 baseline and differential
GenevisibleiQ5FWF4 HS

Family and domain databases

CDDicd00085 HNHc, 1 hit
Gene3Di3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR002711 HNH
IPR003615 HNH_nuc
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf
PfamiView protein in Pfam
PF00271 Helicase_C, 1 hit
PF01844 HNH, 1 hit
PF00176 SNF2_N, 1 hit
PF00641 zf-RanBP, 1 hit
SMARTiView protein in SMART
SM00487 DEXDc, 1 hit
SM00490 HELICc, 1 hit
SM00507 HNHc, 1 hit
SM00547 ZnF_RBZ, 1 hit
SUPFAMiSSF52540 SSF52540, 2 hits
SSF90209 SSF90209, 1 hit
PROSITEiView protein in PROSITE
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01358 ZF_RANBP2_1, 1 hit
PS50199 ZF_RANBP2_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZRAB3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5FWF4
Secondary accession number(s): B3KYA1
, B4E375, B5MDI3, D3DP76, E9PBP0, Q53SM1, Q6P2C4, Q8N1P4, Q9H0E8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2005
Last modified: June 17, 2020
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again