Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5FBB7 (SGO1_HUMAN)

Entry version 136 (13 Feb 2019)
Sequence version 1 (15 Mar 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Shugoshin 1

Gene

SGO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity. Involved in centromeric enrichment of AUKRB in prometaphase.8 Publications

Miscellaneous

Shugoshin is Japanese for guardian spirit (as it is known to be a protector of centromeric cohesin).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • kinase binding Source: MGI
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-68877 Mitotic Prometaphase

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q5FBB7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Shugoshin 1Imported
Alternative name(s):
Serologically defined breast cancer antigen NY-BR-85
Shugoshin-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SGO1Imported
Synonyms:SGOL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000129810.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:25088 SGO1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609168 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5FBB7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Chronic atrial and intestinal dysrhythmia (CAID)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease characterized by dysregulation of the cardiac sinus node resulting in sick sinus syndrome, in association with chronic intestinal pseudo-obstruction, a disorder of gastrointestinal motility in which intestinal obstruction occurs in the absence of a mechanical obstacle.
See also OMIM:616201
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07270923K → E in CAID; patient fibroblasts exhibit significantly faster cell proliferation than controls; during mitosis the mutant protein is localized in an ordered fashion around the centromeres but display a rather homogeneous cytoplasmic localization pattern. 1 PublicationCorresponds to variant dbSNP:rs199815268EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi14S → A: Loss of phosphorylation and presence of misaligned chromosomes; when associated with A-507. 1 Publication1
Mutagenesisi61N → I: Loss of interaction with PPP2CA and PPP2R1A and loss of centromeric localization. 1 Publication1
Mutagenesisi73S → A: Loss of proper localization to spindle pole and mitotic spindle. Significant increase in split spindle poles. 1 Publication1
Mutagenesisi146T → A: Loss of proper localization to spindle pole and mitotic spindle. Significant increase in split spindle poles. 1 Publication1
Mutagenesisi451P → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-453 and A-455. 1 Publication1
Mutagenesisi453V → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-451 and A-455. 1 Publication1
Mutagenesisi455I → A: Disrupts interaction with CBX5, loss of localization to centromeres in interphase, no effect on localization to centromeres in mitosis; when associated with A-451 and A-453. 1 Publication1
Mutagenesisi492K → A: Loss of centromeric localization. 1 Publication1
Mutagenesisi507S → A: Loss of phosphorylation; and presence of misaligned chromosomes; when associated with A-14. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		151648

MalaCards human disease database

More...MalaCardsi		SGO1
MIMi616201 phenotype

Open Targets

More...OpenTargetsi		ENSG00000129810

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		435988 Chronic atrial and intestinal dysrhythmia syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134988556

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SGO1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74741474

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000554361 – 561Shugoshin 1Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14Phosphoserine; by NEK21 Publication1
Modified residuei256PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei507Phosphoserine; by NEK2Combined sources1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated and degraded during mitotic exit by APC/C-Cdh1.1 Publication
Phosphorylation by NEK2 is essential for chromosome congression in mitosis and for the proper attachment of spindle microtubule to the kinetochore. Phosphorylated by PLK1 and AUKRB.3 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5FBB7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5FBB7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5FBB7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5FBB7

PeptideAtlas

More...PeptideAtlasi		Q5FBB7

PRoteomics IDEntifications database

More...PRIDEi		Q5FBB7

ProteomicsDB human proteome resource

More...ProteomicsDBi		62781
62782 [Q5FBB7-2]
62783 [Q5FBB7-3]
62784 [Q5FBB7-4]
62785 [Q5FBB7-5]
62786 [Q5FBB7-6]
62787 [Q5FBB7-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5FBB7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5FBB7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Appears in prophase cells and remains present until metaphase. Strongly decreases at the onset of anaphase and completely disappears at telophase. Not present in interphase cells (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000129810 Expressed in 89 organ(s), highest expression level in buccal mucosa cell

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5FBB7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5FBB7 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA035501
HPA069857

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PPP2CA (or PPP2CB), PPP2R1B, PPP2R5A, PPP2R5B, PPP2R5C, PPP2R5D, PPP2R5E, SET, LRRC59, RBM10 (or RBM5), RPL10A, RPL28, RPL7, RPL7A and RPLP1. Interaction with protein phosphatase 2A occurs most probably through direct binding to the regulatory B56 subunits: PPP2R1B, PPP2R5A, PPP2R5B, PPP2R5C, PPP2R5D, PPP2R5E. Interacts with PPP2R1A and NEK2. Isoform 3 interacts with PLK1. Interacts with CDCA8.5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		127395, 85 interactors

Database of interacting proteins

More...DIPi		DIP-36614N

Protein interaction database and analysis system

More...IntActi		Q5FBB7, 48 interactors

Molecular INTeraction database

More...MINTi		Q5FBB7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000263753

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FGAX-ray2.70D51-96[»]
3Q6SX-ray1.93E/F445-463[»]
4A0IX-ray2.60C/D2-6[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q5FBB7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5FBB7

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q5FBB7

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 176Necessary for interaction with PPP2CA and PPP2R1A1 PublicationAdd BLAST176

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili7 – 89Sequence analysisAdd BLAST83
Coiled coili273 – 313Sequence analysisAdd BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi192 – 200D-box 19
Motifi310 – 312KEN box3
Motifi438 – 446D-box 29
Motifi451 – 455PXVXL/I motif1 Publication5
Motifi457 – 465D-box 39

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KEN box and D-box 3 are required for its ubiquitination and degradation.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the shugoshin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IPKX Eukaryota
ENOG4111FBS LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154107

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG080777

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5FBB7

KEGG Orthology (KO)

More...KOi		K11580

Identification of Orthologs from Complete Genome Data

More...OMAi		LYLPTCK

Database of Orthologous Groups

More...OrthoDBi		1414582at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5FBB7

TreeFam database of animal gene trees

More...TreeFami		TF334213

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028321 Sgo1
IPR038889 Shugoshin
IPR011515 Shugoshin_C
IPR011516 Shugoshin_N

The PANTHER Classification System

More...PANTHERi		PTHR21577 PTHR21577, 1 hit
PTHR21577:SF3 PTHR21577:SF3, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07557 Shugoshin_C, 1 hit
PF07558 Shugoshin_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5FBB7-1) [UniParc]FASTAAdd to basket
Also known as: 1EF, SgoL1-A2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKERCLKKS FQDSLEDIKK RMKEKRNKNL AEIGKRRSFI AAPCQIITNT 
        60         70         80         90        100
STLLKNYQDN NKMLVLALEN EKSKVKEAQD IILQLRKECY YLTCQLYALK 
       110        120        130        140        150
GKLTSQQTVE PAQNQEICSS GMDPNSDDSS RNLFVKDLPQ IPLEETELPG 
       160        170        180        190        200
QGESFQIEDQ IPTIPQDTLG VDFDSGEAKS TDNVLPRTVS VRSSLKKHCN 
       210        220        230        240        250
SICQFDSLDD FETSHLAGKS FEFERVGFLD PLVNMHIPEN VQHNACQWSK 
       260        270        280        290        300
DQVNLSPKLI QPGTFTKTKE DILESKSEQT KSKQRDTQER KREEKRKANR 
       310        320        330        340        350
RKSKRMSKYK ENKSENKKTV PQKKMHKSVS SNDAYNFNLE EGVHLTPFRQ 
       360        370        380        390        400
KVSNDSNREE NNESEVSLCE SSGSGDDSDD LYLPTCKYIQ NPTSNSDRPV 
       410        420        430        440        450
TRPLAKRALK YTDEKETEGS KPTKTPTTTP PETQQSPHLS LKDITNVSLY 
       460        470        480        490        500
PVVKIRRLSL SPKKNKASPA VALPKRRCTA SVNYKEPTLA SKLRRGDPFT 
       510        520        530        540        550
DLCFLNSPIF KQKKDLRRSK KRALEVSPAK EAIFILYYVR EFVSRFPDCR 
       560 
KCKLETHICL R
Length:561
Mass (Da):64,190
Last modified:March 15, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i90CEE0FD2B40CD9C
GO
Isoform 2 (identifier: Q5FBB7-2) [UniParc]FASTAAdd to basket
Also known as: 1GH, SgoL1-B2

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → A
     177-428: Missing.

Show »
Length:309
Mass (Da):35,344
Checksum:iA8322EF03909112C
GO
Isoform 3 (identifier: Q5FBB7-3) [UniParc]FASTAAdd to basket
Also known as: 1KL, sSGO1, SgoL1-C2

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: D → A
     160-428: Missing.

Show »
Length:292
Mass (Da):33,501
Checksum:i9E23E55D203774D7
GO
Isoform 4 (identifier: Q5FBB7-4) [UniParc]FASTAAdd to basket
Also known as: 1CD, SgoL1-B1

The sequence of this isoform differs from the canonical sequence as follows:
     176-176: G → A
     177-428: Missing.
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:275
Mass (Da):31,276
Checksum:iFF0A4DC6D2F778D5
GO
Isoform 5 (identifier: Q5FBB7-5) [UniParc]FASTAAdd to basket
Also known as: 1AB, SgoL1-C1

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: D → A
     160-428: Missing.
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:258
Mass (Da):29,433
Checksum:i402AA77D4FDCAA74
GO
Isoform 6 (identifier: Q5FBB7-6) [UniParc]FASTAAdd to basket
Also known as: 1AB, SgoL1-A1

The sequence of this isoform differs from the canonical sequence as follows:
     522-561: RALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR → SMKQIQ

Show »
Length:527
Mass (Da):60,122
Checksum:i7ADB8B2C0B960A92
GO
Isoform 7 (identifier: Q5FBB7-7) [UniParc]FASTAAdd to basket
Also known as: 1J

The sequence of this isoform differs from the canonical sequence as follows:
     177-522: Missing.

Show »
Length:215
Mass (Da):24,646
Checksum:i6FBC1BCA822DC3F4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WB17F8WB17_HUMAN
Shugoshin 1
SGO1
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH01339 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH32696 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07270923K → E in CAID; patient fibroblasts exhibit significantly faster cell proliferation than controls; during mitosis the mutant protein is localized in an ordered fashion around the centromeres but display a rather homogeneous cytoplasmic localization pattern. 1 PublicationCorresponds to variant dbSNP:rs199815268EnsemblClinVar.1
Natural variantiVAR_051968171V → A. Corresponds to variant dbSNP:rs6806241Ensembl.1
Natural variantiVAR_051969322Q → P. Corresponds to variant dbSNP:rs9868701Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016790159D → A in isoform 3 and isoform 5. 3 Publications1
Alternative sequenceiVSP_016791160 – 428Missing in isoform 3 and isoform 5. 3 PublicationsAdd BLAST269
Alternative sequenceiVSP_016792176G → A in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_016793177 – 522Missing in isoform 7. 1 PublicationAdd BLAST346
Alternative sequenceiVSP_016794177 – 428Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST252
Alternative sequenceiVSP_016795522 – 561RALEV…HICLR → SMKQIQ in isoform 4, isoform 5 and isoform 6. 4 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB190994 mRNA Translation: BAD91318.1
AB193056 mRNA Translation: BAD95529.1
AB193057 mRNA Translation: BAD95530.1
AB193058 mRNA Translation: BAD95531.1
AB193059 mRNA Translation: BAD95532.1
AB193060 mRNA Translation: BAD95533.1
AB193061 mRNA Translation: BAD95534.1
AB193062 mRNA Translation: BAD95535.1
AB193063 mRNA Translation: BAD95536.1
AB193064 mRNA Translation: BAD95537.1
AB193065 mRNA Translation: BAD95538.1
AB193066 mRNA Translation: BAD95539.1
AB187577 mRNA Translation: BAD89587.1
AB187578 mRNA Translation: BAD89588.1
AB187579 mRNA Translation: BAD89589.1
AB187580 mRNA Translation: BAD89590.1
AB187581 mRNA Translation: BAD89591.1
AB187582 mRNA Translation: BAD89592.1
BC001339 mRNA Translation: AAH01339.2 Different initiation.
BC017867 mRNA Translation: AAH17867.1
BC032696 mRNA Translation: AAH32696.1 Different initiation.
AF308299 mRNA Translation: AAG48266.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2635.1 [Q5FBB7-3]
CCDS33716.1 [Q5FBB7-1]
CCDS46771.1 [Q5FBB7-2]
CCDS46772.1 [Q5FBB7-5]
CCDS46773.1 [Q5FBB7-6]
CCDS46774.1 [Q5FBB7-4]
CCDS56243.1 [Q5FBB7-7]

NCBI Reference Sequences

More...RefSeqi		NP_001012409.1, NM_001012409.3 [Q5FBB7-6]
NP_001012410.1, NM_001012410.4 [Q5FBB7-1]
NP_001012411.1, NM_001012411.3 [Q5FBB7-4]
NP_001012412.1, NM_001012412.4 [Q5FBB7-2]
NP_001012413.1, NM_001012413.3 [Q5FBB7-5]
NP_001186180.1, NM_001199251.2 [Q5FBB7-6]
NP_001186181.1, NM_001199252.2 [Q5FBB7-1]
NP_001186182.1, NM_001199253.2 [Q5FBB7-4]
NP_001186183.1, NM_001199254.2 [Q5FBB7-2]
NP_001186184.1, NM_001199255.2 [Q5FBB7-5]
NP_001186185.1, NM_001199256.2 [Q5FBB7-3]
NP_001186186.1, NM_001199257.2 [Q5FBB7-7]
NP_612493.1, NM_138484.4 [Q5FBB7-3]
XP_011531675.1, XM_011533373.2 [Q5FBB7-1]
XP_011531677.1, XM_011533375.2 [Q5FBB7-1]
XP_011531678.1, XM_011533376.2 [Q5FBB7-1]
XP_011531679.1, XM_011533377.2 [Q5FBB7-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.105153

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000263753; ENSP00000263753; ENSG00000129810 [Q5FBB7-1]
ENST00000306698; ENSP00000306581; ENSG00000129810 [Q5FBB7-3]
ENST00000412997; ENSP00000410458; ENSG00000129810 [Q5FBB7-6]
ENST00000417364; ENSP00000394613; ENSG00000129810 [Q5FBB7-4]
ENST00000419233; ENSP00000394625; ENSG00000129810 [Q5FBB7-2]
ENST00000421451; ENSP00000414129; ENSG00000129810 [Q5FBB7-1]
ENST00000425061; ENSP00000414960; ENSG00000129810 [Q5FBB7-2]
ENST00000437051; ENSP00000389034; ENSG00000129810 [Q5FBB7-4]
ENST00000442720; ENSP00000394957; ENSG00000129810 [Q5FBB7-5]
ENST00000443724; ENSP00000413070; ENSG00000129810 [Q5FBB7-7]
ENST00000452020; ENSP00000411200; ENSG00000129810 [Q5FBB7-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		151648

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:151648

UCSC genome browser

More...UCSCi		uc003cbr.4 human [Q5FBB7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB190994 mRNA Translation: BAD91318.1
AB193056 mRNA Translation: BAD95529.1
AB193057 mRNA Translation: BAD95530.1
AB193058 mRNA Translation: BAD95531.1
AB193059 mRNA Translation: BAD95532.1
AB193060 mRNA Translation: BAD95533.1
AB193061 mRNA Translation: BAD95534.1
AB193062 mRNA Translation: BAD95535.1
AB193063 mRNA Translation: BAD95536.1
AB193064 mRNA Translation: BAD95537.1
AB193065 mRNA Translation: BAD95538.1
AB193066 mRNA Translation: BAD95539.1
AB187577 mRNA Translation: BAD89587.1
AB187578 mRNA Translation: BAD89588.1
AB187579 mRNA Translation: BAD89589.1
AB187580 mRNA Translation: BAD89590.1
AB187581 mRNA Translation: BAD89591.1
AB187582 mRNA Translation: BAD89592.1
BC001339 mRNA Translation: AAH01339.2 Different initiation.
BC017867 mRNA Translation: AAH17867.1
BC032696 mRNA Translation: AAH32696.1 Different initiation.
AF308299 mRNA Translation: AAG48266.1
CCDSiCCDS2635.1 [Q5FBB7-3]
CCDS33716.1 [Q5FBB7-1]
CCDS46771.1 [Q5FBB7-2]
CCDS46772.1 [Q5FBB7-5]
CCDS46773.1 [Q5FBB7-6]
CCDS46774.1 [Q5FBB7-4]
CCDS56243.1 [Q5FBB7-7]
RefSeqiNP_001012409.1, NM_001012409.3 [Q5FBB7-6]
NP_001012410.1, NM_001012410.4 [Q5FBB7-1]
NP_001012411.1, NM_001012411.3 [Q5FBB7-4]
NP_001012412.1, NM_001012412.4 [Q5FBB7-2]
NP_001012413.1, NM_001012413.3 [Q5FBB7-5]
NP_001186180.1, NM_001199251.2 [Q5FBB7-6]
NP_001186181.1, NM_001199252.2 [Q5FBB7-1]
NP_001186182.1, NM_001199253.2 [Q5FBB7-4]
NP_001186183.1, NM_001199254.2 [Q5FBB7-2]
NP_001186184.1, NM_001199255.2 [Q5FBB7-5]
NP_001186185.1, NM_001199256.2 [Q5FBB7-3]
NP_001186186.1, NM_001199257.2 [Q5FBB7-7]
NP_612493.1, NM_138484.4 [Q5FBB7-3]
XP_011531675.1, XM_011533373.2 [Q5FBB7-1]
XP_011531677.1, XM_011533375.2 [Q5FBB7-1]
XP_011531678.1, XM_011533376.2 [Q5FBB7-1]
XP_011531679.1, XM_011533377.2 [Q5FBB7-1]
UniGeneiHs.105153

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FGAX-ray2.70D51-96[»]
3Q6SX-ray1.93E/F445-463[»]
4A0IX-ray2.60C/D2-6[»]
ProteinModelPortaliQ5FBB7
SMRiQ5FBB7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127395, 85 interactors
DIPiDIP-36614N
IntActiQ5FBB7, 48 interactors
MINTiQ5FBB7
STRINGi9606.ENSP00000263753

PTM databases

iPTMnetiQ5FBB7
PhosphoSitePlusiQ5FBB7

Polymorphism and mutation databases

BioMutaiSGO1
DMDMi74741474

Proteomic databases

EPDiQ5FBB7
jPOSTiQ5FBB7
MaxQBiQ5FBB7
PaxDbiQ5FBB7
PeptideAtlasiQ5FBB7
PRIDEiQ5FBB7
ProteomicsDBi62781
62782 [Q5FBB7-2]
62783 [Q5FBB7-3]
62784 [Q5FBB7-4]
62785 [Q5FBB7-5]
62786 [Q5FBB7-6]
62787 [Q5FBB7-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263753; ENSP00000263753; ENSG00000129810 [Q5FBB7-1]
ENST00000306698; ENSP00000306581; ENSG00000129810 [Q5FBB7-3]
ENST00000412997; ENSP00000410458; ENSG00000129810 [Q5FBB7-6]
ENST00000417364; ENSP00000394613; ENSG00000129810 [Q5FBB7-4]
ENST00000419233; ENSP00000394625; ENSG00000129810 [Q5FBB7-2]
ENST00000421451; ENSP00000414129; ENSG00000129810 [Q5FBB7-1]
ENST00000425061; ENSP00000414960; ENSG00000129810 [Q5FBB7-2]
ENST00000437051; ENSP00000389034; ENSG00000129810 [Q5FBB7-4]
ENST00000442720; ENSP00000394957; ENSG00000129810 [Q5FBB7-5]
ENST00000443724; ENSP00000413070; ENSG00000129810 [Q5FBB7-7]
ENST00000452020; ENSP00000411200; ENSG00000129810 [Q5FBB7-3]
GeneIDi151648
KEGGihsa:151648
UCSCiuc003cbr.4 human [Q5FBB7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		151648
DisGeNETi151648
EuPathDBiHostDB:ENSG00000129810.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		SGO1
HGNCiHGNC:25088 SGO1
HPAiHPA035501
HPA069857
MalaCardsiSGO1
MIMi609168 gene
616201 phenotype
neXtProtiNX_Q5FBB7
OpenTargetsiENSG00000129810
Orphaneti435988 Chronic atrial and intestinal dysrhythmia syndrome
PharmGKBiPA134988556

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IPKX Eukaryota
ENOG4111FBS LUCA
GeneTreeiENSGT00940000154107
HOVERGENiHBG080777
InParanoidiQ5FBB7
KOiK11580
OMAiLYLPTCK
OrthoDBi1414582at2759
PhylomeDBiQ5FBB7
TreeFamiTF334213

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-68877 Mitotic Prometaphase
SIGNORiQ5FBB7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SGO1 human
EvolutionaryTraceiQ5FBB7

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SGOL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		151648

Protein Ontology

More...PROi		PR:Q5FBB7

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000129810 Expressed in 89 organ(s), highest expression level in buccal mucosa cell
ExpressionAtlasiQ5FBB7 baseline and differential
GenevisibleiQ5FBB7 HS

Family and domain databases

InterProiView protein in InterPro
IPR028321 Sgo1
IPR038889 Shugoshin
IPR011515 Shugoshin_C
IPR011516 Shugoshin_N
PANTHERiPTHR21577 PTHR21577, 1 hit
PTHR21577:SF3 PTHR21577:SF3, 1 hit
PfamiView protein in Pfam
PF07557 Shugoshin_C, 1 hit
PF07558 Shugoshin_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSGO1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5FBB7
Secondary accession number(s): Q588H5
, Q5FBB4, Q5FBB5, Q5FBB6, Q5FBB8, Q8N579, Q8WVL0, Q9BVA8, Q9H275
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: March 15, 2005
Last modified: February 13, 2019
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again