Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear fragile X mental retardation-interacting protein 2

Gene

Nufip2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds RNA.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear fragile X mental retardation-interacting protein 2
Alternative name(s):
82 kDa FMRP-interacting protein
Short name:
82-FIP
FMRP-interacting protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nufip2
Synonyms:Kiaa1321
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1915814 Nufip2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002455221 – 692Nuclear fragile X mental retardation-interacting protein 2Add BLAST692

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki79Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei88PhosphothreonineBy similarity1
Cross-linki110Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei113PhosphoserineCombined sources1
Modified residuei114PhosphoserineBy similarity1
Cross-linki137Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki147Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki172Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei213PhosphoserineCombined sources1
Modified residuei215PhosphoserineCombined sources1
Modified residuei219PhosphotyrosineBy similarity1
Modified residuei220PhosphothreonineBy similarity1
Modified residuei221PhosphothreonineBy similarity1
Cross-linki262Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki281Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei291Omega-N-methylarginineBy similarity1
Cross-linki293Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei304PhosphoserineBy similarity1
Cross-linki307Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei376PhosphoserineBy similarity1
Modified residuei569PhosphothreonineBy similarity1
Modified residuei570PhosphoserineCombined sources1
Modified residuei589PhosphoserineBy similarity1
Modified residuei605PhosphoserineBy similarity1
Modified residuei626PhosphoserineCombined sources1
Modified residuei630PhosphothreonineBy similarity1
Modified residuei634PhosphoserineBy similarity1
Modified residuei649PhosphoserineCombined sources1
Modified residuei652PhosphoserineCombined sources1
Modified residuei689PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5F2E7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5F2E7

PeptideAtlas

More...
PeptideAtlasi
Q5F2E7

PRoteomics IDEntifications database

More...
PRIDEi
Q5F2E7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5F2E7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5F2E7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037857 Expressed in 242 organ(s), highest expression level in mesenteric lymph node

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5F2E7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FMR1 (via N-terminus) (PubMed:12837692). Interacts with DDX6 (By similarity).By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
212929, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q5F2E7, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000098365

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5F2E7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5F2E7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi12 – 61His-richAdd BLAST50
Compositional biasi373 – 414Ser-richAdd BLAST42

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGEW Eukaryota
ENOG41102P5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000038328

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220869

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG065794

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5F2E7

Identification of Orthologs from Complete Genome Data

More...
OMAi
EMESVWN

Database of Orthologous Groups

More...
OrthoDBi
EOG091G040J

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5F2E7

TreeFam database of animal gene trees

More...
TreeFami
TF332832

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032747 NUFIP2

The PANTHER Classification System

More...
PANTHERi
PTHR28333 PTHR28333, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15293 NUFIP2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5F2E7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEKPGQPQP QHHHSHHHPH HHPQQQQQQQ SHHHHHYYFY NHSHNHHHHH
60 70 80 90 100
HHQQPHQYLQ HGAEGSPKAQ PKPLKHEQKH TLQQHQETPK KKTGYGEING
110 120 130 140 150
NAGEREISLK SLSSDEATNP ISRVLNGNQQ VVETSLKQTV KTSTFGKAGI
160 170 180 190 200
KTKNFIQKNS MDKKNGKSYE NKSGETQAVD KTDTIAIPNG VITSSSGYIT
210 220 230 240 250
NGYMSKGADN DGSGSESGYT TPKKRKARRN SAKGCENLNL VQDKIMQETS
260 270 280 290 300
VPALKQGLET LKPDYSEQKG MRVDGSKPIW KYETGPGGTS RGKPAMGDVL
310 320 330 340 350
RKSSDIKPGL SSKKFDDRPK GKHASAAASK EDSWTLFKPP PVFPVDNSSA
360 370 380 390 400
KIVPKISYAS KVKENLNKTV QNSSVSPSSS SSSSSTGETQ TQSSSRLSQV
410 420 430 440 450
PMSALKSVTS ASFSNGPVLA GTDGSVYPSG GQPLLTTAAN TLTPISTGTD
460 470 480 490 500
SVLQDMSLAS AAVEQIKSSL FIYPSNMQTV LLSAQVDLPS QTDQQNLGDI
510 520 530 540 550
FQNQWGLSFI NEPSAGPETV IGKSSDHKVM EVTFQGEYPA TLVSQGAEII
560 570 580 590 600
PSGTEHPVFP KAYELEKRTS PQVLGHILKP GTTESGALSL DPSHIGDLQK
610 620 630 640 650
ADTSSQGALV FLSKDYEIEN QNPLASPTNT LLGSAKEQRY QRGLERNDSW
660 670 680 690
GSFDLRAAIV YHTKEMESIW NLQKQDPKRI ITYNEAMDSP DQ
Length:692
Mass (Da):75,657
Last modified:March 15, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3E295AC111814564
GO
Isoform 2 (identifier: Q5F2E7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     676-692: DPKRIITYNEAMDSPDQ → VFCLCVYMYTYVHHVMSLHGRERTLDPLELALHWS

Note: No experimental confirmation available.
Show »
Length:710
Mass (Da):77,885
Checksum:i3123F4711F98E38B
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65776 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti52Missing in BAE42015 (PubMed:16141072).Curated1
Sequence conflicti57Q → R in BAE42015 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019729676 – 692DPKRI…DSPDQ → VFCLCVYMYTYVHHVMSLHG RERTLDPLELALHWS in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122494 mRNA Translation: BAC65776.1 Different initiation.
AK132603 mRNA Translation: BAE21256.1
AK152336 mRNA Translation: BAE31134.1
AK160601 mRNA Translation: BAE35905.1
AK170764 mRNA Translation: BAE42015.1
AL591136 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25083.1 [Q5F2E7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001019376.1, NM_001024205.2 [Q5F2E7-1]
XP_006534125.1, XM_006534062.3 [Q5F2E7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.428996

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857 [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857 [Q5F2E7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
68564

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:68564

UCSC genome browser

More...
UCSCi
uc007khd.2 mouse [Q5F2E7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122494 mRNA Translation: BAC65776.1 Different initiation.
AK132603 mRNA Translation: BAE21256.1
AK152336 mRNA Translation: BAE31134.1
AK160601 mRNA Translation: BAE35905.1
AK170764 mRNA Translation: BAE42015.1
AL591136 Genomic DNA No translation available.
CCDSiCCDS25083.1 [Q5F2E7-1]
RefSeqiNP_001019376.1, NM_001024205.2 [Q5F2E7-1]
XP_006534125.1, XM_006534062.3 [Q5F2E7-1]
UniGeneiMm.428996

3D structure databases

ProteinModelPortaliQ5F2E7
SMRiQ5F2E7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi212929, 4 interactors
IntActiQ5F2E7, 2 interactors
STRINGi10090.ENSMUSP00000098365

PTM databases

iPTMnetiQ5F2E7
PhosphoSitePlusiQ5F2E7

Proteomic databases

EPDiQ5F2E7
PaxDbiQ5F2E7
PeptideAtlasiQ5F2E7
PRIDEiQ5F2E7

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
68564
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000100802; ENSMUSP00000098365; ENSMUSG00000037857 [Q5F2E7-1]
ENSMUST00000181023; ENSMUSP00000137922; ENSMUSG00000037857 [Q5F2E7-2]
GeneIDi68564
KEGGimmu:68564
UCSCiuc007khd.2 mouse [Q5F2E7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57532
MGIiMGI:1915814 Nufip2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IGEW Eukaryota
ENOG41102P5 LUCA
GeneTreeiENSGT00440000038328
HOGENOMiHOG000220869
HOVERGENiHBG065794
InParanoidiQ5F2E7
OMAiEMESVWN
OrthoDBiEOG091G040J
PhylomeDBiQ5F2E7
TreeFamiTF332832

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q5F2E7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037857 Expressed in 242 organ(s), highest expression level in mesenteric lymph node
GenevisibleiQ5F2E7 MM

Family and domain databases

InterProiView protein in InterPro
IPR032747 NUFIP2
PANTHERiPTHR28333 PTHR28333, 1 hit
PfamiView protein in Pfam
PF15293 NUFIP2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNUFP2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5F2E7
Secondary accession number(s): Q3TCE2, Q3V195, Q80TF1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 15, 2005
Last modified: September 12, 2018
This is version 103 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again