Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (12 Aug 2020)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DnaJ homolog subfamily C member 21

Gene

DNAJC21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a co-chaperone for HSP70. May play a role in ribosomal RNA (rRNA) biogenesis, possibly in the maturation of the 60S subunit. Binds the precursor 45S rRNA.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri314 – 338C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri482 – 506C2H2-type 2PROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • protein folding Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5F1R6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DnaJ homolog subfamily C member 21
Alternative name(s):
DnaJ homolog subfamily A member 5
Protein GS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAJC21
Synonyms:DNAJA5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168724.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27030, DNAJC21

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617048, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5F1R6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Bone marrow failure syndrome 3 (BMFS3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of bone marrow failure syndrome, a heterogeneous group of life-threatening disorders characterized by hematopoietic defects in association with a range of variable extra hematopoietic features. BMFS3 is characterized by pancytopenia with onset in early childhood. Some patients have additional variable non-specific features, including poor growth, microcephaly, and skin anomalies. BMFS3 inheritance is autosomal recessive.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07680232P → A in BMFS3; loss of HSPA8-binding; no effect on PA2G4-, nor on ZNF622-binding. 1 PublicationCorresponds to variant dbSNP:rs879253818EnsemblClinVar.1

Organism-specific databases

DisGeNET

More...
DisGeNETi
134218

MalaCards human disease database

More...
MalaCardsi
DNAJC21
MIMi617052, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000168724

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
811, Shwachman-Diamond syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162383874

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5F1R6, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAJC21

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434479

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002814751 – 531DnaJ homolog subfamily C member 21Add BLAST531

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei283PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei370PhosphoserineCombined sources1
Modified residuei511PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5F1R6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5F1R6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5F1R6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5F1R6

PeptideAtlas

More...
PeptideAtlasi
Q5F1R6

PRoteomics IDEntifications database

More...
PRIDEi
Q5F1R6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62776 [Q5F1R6-1]
62777 [Q5F1R6-2]
62778 [Q5F1R6-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5F1R6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5F1R6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, placenta, kidney and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168724, Expressed in testis and 219 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5F1R6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5F1R6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000168724, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HSPA8, PA2G4 and ZNF622.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126389, 20 interactors

Protein interaction database and analysis system

More...
IntActi
Q5F1R6, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371451

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5F1R6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5F1R6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 69JPROSITE-ProRule annotationAdd BLAST67

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi225 – 375Glu-richAdd BLAST151
Compositional biasi384 – 392Poly-Lys9

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri314 – 338C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri482 – 506C2H2-type 2PROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0714, Eukaryota
KOG0717, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000047097

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009539_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5F1R6

KEGG Orthology (KO)

More...
KOi
K09506

Identification of Orthologs from Complete Genome Data

More...
OMAi
RTFYNYW

Database of Orthologous Groups

More...
OrthoDBi
858842at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5F1R6

TreeFam database of animal gene trees

More...
TreeFami
TF314518

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06257, DnaJ, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.110, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001623, DnaJ_domain
IPR018253, DnaJ_domain_CS
IPR036869, J_dom_sf
IPR003604, Matrin/U1-like-C_Znf_C2H2
IPR022755, Znf_C2H2_jaz
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00226, DnaJ, 1 hit
PF12171, zf-C2H2_jaz, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00625, JDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00271, DnaJ, 1 hit
SM00355, ZnF_C2H2, 2 hits
SM00451, ZnF_U1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46565, SSF46565, 1 hit
SSF57667, SSF57667, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00636, DNAJ_1, 1 hit
PS50076, DNAJ_2, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 2 hits
PS50157, ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5F1R6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKCHYEALGV RRDASEEELK KAYRKLALKW HPDKNLDNAA EAAEQFKLIQ
60 70 80 90 100
AAYDVLSDPQ ERAWYDNHRE ALLKGGFDGE YQDDSLDLLR YFTVTCYSGY
110 120 130 140 150
GDDEKGFYTV YRNVFEMIAK EELESVLEEE VDDFPTFGDS QSDYDTVVHP
160 170 180 190 200
FYAYWQSFCT QKNFAWKEEY DTRQASNRWE KRAMEKENKK IRDKARKEKN
210 220 230 240 250
ELVRQLVAFI RKRDKRVQAH RKLVEEQNAE KARKAEEMRR QQKLKQAKLV
260 270 280 290 300
EQYREQSWMT MANLEKELQE MEARYEKEFG DGSDENEMEE HELKDEEDGK
310 320 330 340 350
DSDEAEDAEL YDDLYCPACD KSFKTEKAMK NHEKSKKHRE MVALLKQQLE
360 370 380 390 400
EEEENFSRPQ IDENPLDDNS EEEMEDAPKQ KLSKKQKKKK QKPAQNYDDN
410 420 430 440 450
FNVNGPGEGV KVDPEDTNLN QDSAKELEDS PQENVSVTEI IKPCDDPKSE
460 470 480 490 500
AKSVPKPKGK KTKDMKKPVR VPAEPQTMSV LISCTTCHSE FPSRNKLFDH
510 520 530
LKATGHARAP SSSSLNSATS SQSKKEKRKN R
Length:531
Mass (Da):62,028
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD1D3ED9AD6505613
GO
Isoform 2 (identifier: Q5F1R6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-395: Q → QDVPGKDSYLPAAHFQMAWGKKCVLGERRDGESEHKCAKMLLENRQ

Show »
Length:576
Mass (Da):67,141
Checksum:iAA936DB87C834334
GO
Isoform 3 (identifier: Q5F1R6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-381: K → KVKYLTFRFIFALR

Show »
Length:544
Mass (Da):63,684
Checksum:i59B109CAB7597022
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y4N5A0A2R8Y4N5_HUMAN
DnaJ homolog subfamily C member 21
DNAJC21
353Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4Q0A0A2R8Y4Q0_HUMAN
DnaJ homolog subfamily C member 21
DNAJC21
473Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y534A0A2R8Y534_HUMAN
DnaJ homolog subfamily C member 21
DNAJC21
415Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YET8A0A2R8YET8_HUMAN
DnaJ homolog subfamily C member 21
DNAJC21
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH65745 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAI07578 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC87112 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti509A → V in AAP81807 (PubMed:15067379).Curated1
Sequence conflicti509A → V in AAO46910 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07680232P → A in BMFS3; loss of HSPA8-binding; no effect on PA2G4-, nor on ZNF622-binding. 1 PublicationCorresponds to variant dbSNP:rs879253818EnsemblClinVar.1
Natural variantiVAR_036163214D → N in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_061145433E → K. Corresponds to variant dbSNP:rs34908091Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024004381K → KVKYLTFRFIFALR in isoform 3. 1 Publication1
Alternative sequenceiVSP_024005395Q → QDVPGKDSYLPAAHFQMAWG KKCVLGERRDGESEHKCAKM LLENRQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY258422 mRNA Translation: AAP81807.1
AY177688 mRNA Translation: AAO46910.1
BC050472 mRNA Translation: AAH50472.1
BC065745 mRNA Translation: AAH65745.1 Sequence problems.
BC107577 mRNA Translation: AAI07578.1 Sequence problems.
AK127749 mRNA Translation: BAC87112.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34144.1 [Q5F1R6-1]
CCDS3907.2 [Q5F1R6-2]
CCDS87294.1 [Q5F1R6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001012339.2, NM_001012339.2 [Q5F1R6-1]
NP_001335349.1, NM_001348420.1 [Q5F1R6-3]
NP_919259.3, NM_194283.3 [Q5F1R6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000382021; ENSP00000371451; ENSG00000168724 [Q5F1R6-2]
ENST00000642851; ENSP00000496545; ENSG00000168724 [Q5F1R6-3]
ENST00000648817; ENSP00000497410; ENSG00000168724 [Q5F1R6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
134218

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:134218

UCSC genome browser

More...
UCSCi
uc003jjb.3, human [Q5F1R6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY258422 mRNA Translation: AAP81807.1
AY177688 mRNA Translation: AAO46910.1
BC050472 mRNA Translation: AAH50472.1
BC065745 mRNA Translation: AAH65745.1 Sequence problems.
BC107577 mRNA Translation: AAI07578.1 Sequence problems.
AK127749 mRNA Translation: BAC87112.1 Different initiation.
CCDSiCCDS34144.1 [Q5F1R6-1]
CCDS3907.2 [Q5F1R6-2]
CCDS87294.1 [Q5F1R6-3]
RefSeqiNP_001012339.2, NM_001012339.2 [Q5F1R6-1]
NP_001335349.1, NM_001348420.1 [Q5F1R6-3]
NP_919259.3, NM_194283.3 [Q5F1R6-2]

3D structure databases

SMRiQ5F1R6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126389, 20 interactors
IntActiQ5F1R6, 12 interactors
STRINGi9606.ENSP00000371451

PTM databases

iPTMnetiQ5F1R6
PhosphoSitePlusiQ5F1R6

Polymorphism and mutation databases

BioMutaiDNAJC21
DMDMi296434479

Proteomic databases

EPDiQ5F1R6
jPOSTiQ5F1R6
MassIVEiQ5F1R6
MaxQBiQ5F1R6
PeptideAtlasiQ5F1R6
PRIDEiQ5F1R6
ProteomicsDBi62776 [Q5F1R6-1]
62777 [Q5F1R6-2]
62778 [Q5F1R6-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22862, 50 antibodies

The DNASU plasmid repository

More...
DNASUi
134218

Genome annotation databases

EnsembliENST00000382021; ENSP00000371451; ENSG00000168724 [Q5F1R6-2]
ENST00000642851; ENSP00000496545; ENSG00000168724 [Q5F1R6-3]
ENST00000648817; ENSP00000497410; ENSG00000168724 [Q5F1R6-1]
GeneIDi134218
KEGGihsa:134218
UCSCiuc003jjb.3, human [Q5F1R6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
134218
DisGeNETi134218
EuPathDBiHostDB:ENSG00000168724.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAJC21
HGNCiHGNC:27030, DNAJC21
HPAiENSG00000168724, Low tissue specificity
MalaCardsiDNAJC21
MIMi617048, gene
617052, phenotype
neXtProtiNX_Q5F1R6
OpenTargetsiENSG00000168724
Orphaneti811, Shwachman-Diamond syndrome
PharmGKBiPA162383874

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0714, Eukaryota
KOG0717, Eukaryota
GeneTreeiENSGT00510000047097
HOGENOMiCLU_009539_1_0_1
InParanoidiQ5F1R6
KOiK09506
OMAiRTFYNYW
OrthoDBi858842at2759
PhylomeDBiQ5F1R6
TreeFamiTF314518

Enzyme and pathway databases

PathwayCommonsiQ5F1R6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
134218, 41 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAJC21, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
134218
PharosiQ5F1R6, Tbio

Protein Ontology

More...
PROi
PR:Q5F1R6
RNActiQ5F1R6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168724, Expressed in testis and 219 other tissues
ExpressionAtlasiQ5F1R6, baseline and differential
GenevisibleiQ5F1R6, HS

Family and domain databases

CDDicd06257, DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR001623, DnaJ_domain
IPR018253, DnaJ_domain_CS
IPR036869, J_dom_sf
IPR003604, Matrin/U1-like-C_Znf_C2H2
IPR022755, Znf_C2H2_jaz
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00226, DnaJ, 1 hit
PF12171, zf-C2H2_jaz, 1 hit
PRINTSiPR00625, JDOMAIN
SMARTiView protein in SMART
SM00271, DnaJ, 1 hit
SM00355, ZnF_C2H2, 2 hits
SM00451, ZnF_U1, 1 hit
SUPFAMiSSF46565, SSF46565, 1 hit
SSF57667, SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00636, DNAJ_1, 1 hit
PS50076, DNAJ_2, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 2 hits
PS50157, ZINC_FINGER_C2H2_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDJC21_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5F1R6
Secondary accession number(s): Q3B7J9
, Q6P086, Q6ZS43, Q86VC6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: May 18, 2010
Last modified: August 12, 2020
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again