Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adrenocortical dysplasia protein

Gene

Acd

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends. Without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomere elongation by recruiting telomerase to telomeres and increasing its processivity (By similarity). May play a role in organogenesis (PubMed:15537664).By similarity1 Publication

Miscellaneous

Adrenocortical dysplasia mouse was initially reported as a model of human congenital adrenal hypoplasia (AHC).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA polymerase binding Source: MGI
  • protein binding involved in negative regulation of telomere maintenance via telomerase Source: GO_Central
  • protein-containing complex binding Source: MGI
  • telomeric DNA binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-171306 Packaging Of Telomere Ends
R-MMU-2559586 DNA Damage/Telomere Stress Induced Senescence

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adrenocortical dysplasia protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Acd
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:87873 Acd

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Acd are the cause of adrenocortical dysplasia (ACD). ACD is a spontaneous autosomal recessive mouse mutant resulting from spontaneous splicing mutation of acd. ACD mice are characterized by developmental defects in organs derived from the urogenital ridge, reduced survival, poor growth, skin hyperpigmentation and adrenal insufficiency. Forty percent of the mutants died within 24 hours. Analysis of E14.5 to E17.5 embryos revealed reduced formation of caudal structure as well as limb defects.

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002390201 – 416Adrenocortical dysplasia proteinAdd BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei25PhosphoserineCombined sources1
Modified residuei313PhosphoserineCombined sources1
Modified residuei317PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki345Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5EE38

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5EE38

PeptideAtlas

More...
PeptideAtlasi
Q5EE38

PRoteomics IDEntifications database

More...
PRIDEi
Q5EE38

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5EE38

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5EE38

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed from E7 to E18 throughout development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038000 Expressed in 214 organ(s), highest expression level in thymus

CleanEx database of gene expression profiles

More...
CleanExi
MM_ACD

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5EE38 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5EE38 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the shelterin complex (telosome) composed of TERF1, TERF2, TINF2, TERF2IP ACD and POT1. Forms heterodimers with POT1. Identified in a complex with POT1 and single-stranded telomeric DNA. Interacts with STN1 and TINF2.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-153 Shelterin complex

Database of interacting proteins

More...
DIPi
DIP-29612N

Protein interaction database and analysis system

More...
IntActi
Q5EE38, 9 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000048180

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5EE38

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5EE38

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni156 – 245Interaction with POT1By similarityAdd BLAST90

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi11 – 13PWI3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi236 – 317Ser-richAdd BLAST82

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGMZ Eukaryota
ENOG410YTBM LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004877

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033778

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080817

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5EE38

KEGG Orthology (KO)

More...
KOi
K11114

Identification of Orthologs from Complete Genome Data

More...
OMAi
PALPGHM

Database of Orthologous Groups

More...
OrthoDBi
EOG091G05BM

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5EE38

TreeFam database of animal gene trees

More...
TreeFami
TF338536

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028631 ACD

The PANTHER Classification System

More...
PANTHERi
PTHR14487 PTHR14487, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5EE38-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDSGLLALQ PWIRELILGS ETLSSPRTGQ LLKVLQDSET PGPSSAPDTP
60 70 80 90 100
DTGAVLLVSD GTHSVRCVVT RNAIDTSDWE EKELGFRGTE GRLLLLQACG
110 120 130 140 150
LRVQVAQDHA PAEFYLQVDR FNLLPTEQPR IQVTGCNQDS DVQRKLNECL
160 170 180 190 200
EDHLSESASS SAGLTLSQLL DEVREDQDHR GALVCLAKSC LVLKGPCTTT
210 220 230 240 250
PLTDWITSGS QALGKAVFTV SGSLLHIPEG EEQILSSTGS SQKARGTSAS
260 270 280 290 300
PSHMPLEESG ASVSLLSALA TSDPGQMDSS QSPPAVGSTS PRAQAPTSPP
310 320 330 340 350
CNSTPSSLLL NCSPSLSPLH PAPRSHQSCE TRAQAPKLEF QCSFKKRQLL
360 370 380 390 400
PRTSAQELCS VWEPPERHRD TSAFQYKYET PSASLHTQVQ TARLSPQLVA
410
WALNIVMESE SELTQV
Length:416
Mass (Da):44,713
Last modified:March 15, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i357CB31A8C4639BF
GO
Isoform 2 (identifier: Q5EE38-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     101-136: LRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGC → MKLPPFVSSRALGIDLQVRGMGINNPDHLPPSSSPS

Note: No experimental confirmation available.
Show »
Length:316
Mass (Da):33,731
Checksum:iA46478B40D1752B6
GO
Isoform 3 (identifier: Q5EE38-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-191: Missing.
     192-213: VLKGPCTTTPLTDWITSGSQAL → MCRENSMSVLRTTSQSLLLPVQ

Note: No experimental confirmation available.
Show »
Length:225
Mass (Da):24,126
Checksum:i693277F805084F65
GO
Isoform 4 (identifier: Q5EE38-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-253: Missing.

Note: No experimental confirmation available.
Show »
Length:163
Mass (Da):17,629
Checksum:iE8BFEC040F32A3A5
GO
Isoform 5 (identifier: Q5EE38-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-158: Missing.
     159-162: SSSA → MLAP
     214-232: GKAVFTVSGSLLHIPEGEE → VSAGLFLGGFRGRVRQLPC
     233-416: Missing.

Note: No experimental confirmation available.
Show »
Length:74
Mass (Da):7,883
Checksum:iF74862718297BF4B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RLA2A0A1D5RLA2_MOUSE
Adrenocortical dysplasia protein
Acd
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RM77A0A1D5RM77_MOUSE
Adrenocortical dysplasia protein
Acd
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLU6A0A1D5RLU6_MOUSE
Adrenocortical dysplasia protein
Acd
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti158A → T in BAE35904 (PubMed:16141072).Curated1
Sequence conflicti393R → W in BAE20450 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0190671 – 253Missing in isoform 4. 1 PublicationAdd BLAST253
Alternative sequenceiVSP_0190681 – 191Missing in isoform 3. 1 PublicationAdd BLAST191
Alternative sequenceiVSP_0190691 – 158Missing in isoform 5. 1 PublicationAdd BLAST158
Alternative sequenceiVSP_0190701 – 100Missing in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_019071101 – 136LRVQV…QVTGC → MKLPPFVSSRALGIDLQVRG MGINNPDHLPPSSSPS in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_019072159 – 162SSSA → MLAP in isoform 5. 1 Publication4
Alternative sequenceiVSP_019073192 – 213VLKGP…GSQAL → MCRENSMSVLRTTSQSLLLP VQ in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_019074214 – 232GKAVF…PEGEE → VSAGLFLGGFRGRVRQLPC in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_019075233 – 416Missing in isoform 5. 1 PublicationAdd BLAST184

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY902197 Genomic DNA Translation: AAW82804.1
AK030405 mRNA Translation: BAE20450.1
AK032683 mRNA Translation: BAE43282.1
AK145959 mRNA Translation: BAE26785.1
AK160599 mRNA Translation: BAE35904.1
AK171345 mRNA Translation: BAE42403.1
BC004682 mRNA Translation: AAH04682.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS22608.1 [Q5EE38-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001012656.1, NM_001012638.2 [Q5EE38-1]
NP_001335278.1, NM_001348349.1 [Q5EE38-3]
XP_006531237.1, XM_006531174.3 [Q5EE38-3]
XP_006531238.1, XM_006531175.2 [Q5EE38-3]
XP_006531239.1, XM_006531176.2 [Q5EE38-3]
XP_011246737.1, XM_011248435.2 [Q5EE38-3]
XP_017168377.1, XM_017312888.1 [Q5EE38-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.12964

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042608; ENSMUSP00000048180; ENSMUSG00000038000 [Q5EE38-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
497652

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:497652

UCSC genome browser

More...
UCSCi
uc009ndq.1 mouse [Q5EE38-1]
uc009ndr.1 mouse [Q5EE38-4]
uc009ndt.1 mouse [Q5EE38-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY902197 Genomic DNA Translation: AAW82804.1
AK030405 mRNA Translation: BAE20450.1
AK032683 mRNA Translation: BAE43282.1
AK145959 mRNA Translation: BAE26785.1
AK160599 mRNA Translation: BAE35904.1
AK171345 mRNA Translation: BAE42403.1
BC004682 mRNA Translation: AAH04682.1
CCDSiCCDS22608.1 [Q5EE38-1]
RefSeqiNP_001012656.1, NM_001012638.2 [Q5EE38-1]
NP_001335278.1, NM_001348349.1 [Q5EE38-3]
XP_006531237.1, XM_006531174.3 [Q5EE38-3]
XP_006531238.1, XM_006531175.2 [Q5EE38-3]
XP_006531239.1, XM_006531176.2 [Q5EE38-3]
XP_011246737.1, XM_011248435.2 [Q5EE38-3]
XP_017168377.1, XM_017312888.1 [Q5EE38-3]
UniGeneiMm.12964

3D structure databases

ProteinModelPortaliQ5EE38
SMRiQ5EE38
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

ComplexPortaliCPX-153 Shelterin complex
DIPiDIP-29612N
IntActiQ5EE38, 9 interactors
STRINGi10090.ENSMUSP00000048180

PTM databases

iPTMnetiQ5EE38
PhosphoSitePlusiQ5EE38

Proteomic databases

EPDiQ5EE38
PaxDbiQ5EE38
PeptideAtlasiQ5EE38
PRIDEiQ5EE38

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042608; ENSMUSP00000048180; ENSMUSG00000038000 [Q5EE38-1]
GeneIDi497652
KEGGimmu:497652
UCSCiuc009ndq.1 mouse [Q5EE38-1]
uc009ndr.1 mouse [Q5EE38-4]
uc009ndt.1 mouse [Q5EE38-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65057
MGIiMGI:87873 Acd

Phylogenomic databases

eggNOGiENOG410IGMZ Eukaryota
ENOG410YTBM LUCA
GeneTreeiENSGT00390000004877
HOGENOMiHOG000033778
HOVERGENiHBG080817
InParanoidiQ5EE38
KOiK11114
OMAiPALPGHM
OrthoDBiEOG091G05BM
PhylomeDBiQ5EE38
TreeFamiTF338536

Enzyme and pathway databases

ReactomeiR-MMU-171306 Packaging Of Telomere Ends
R-MMU-2559586 DNA Damage/Telomere Stress Induced Senescence

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q5EE38

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038000 Expressed in 214 organ(s), highest expression level in thymus
CleanExiMM_ACD
ExpressionAtlasiQ5EE38 baseline and differential
GenevisibleiQ5EE38 MM

Family and domain databases

InterProiView protein in InterPro
IPR028631 ACD
PANTHERiPTHR14487 PTHR14487, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACD_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5EE38
Secondary accession number(s): Q3TBB1
, Q3TUR7, Q3UKL6, Q3V3Y1, Q99KF8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: March 15, 2005
Last modified: November 7, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again