Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (02 Jun 2021)
Sequence version 2 (16 Aug 2005)
Previous versions | rss
Add a publicationFeedback
Protein

PDZ domain-containing protein 11

Gene

PDZD11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q5EBL8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-196780, Biotin transport and metabolism
R-HSA-199220, Vitamin B5 (pantothenate) metabolism
R-HSA-425397, Transport of vitamins, nucleosides, and related molecules
R-HSA-6803544, Ion influx/efflux at host-pathogen interface
R-HSA-936837, Ion transport by P-type ATPases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q5EBL8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PDZ domain-containing protein 11
Alternative name(s):
ATPase-interacting PDZ protein
Plasma membrane calcium ATPase-interacting single-PDZ protein
Short name:
PMCA-interacting single-PDZ protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDZD11
Synonyms:AIPP1, PDZK11, PISP
ORF Names:HSPC227, UNQ6486/PRO21335
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28034, PDZD11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300632, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5EBL8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000120509.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000120509

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134968632

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5EBL8, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDZD11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73621365

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000582731 – 140PDZ domain-containing protein 11Add BLAST140

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5EBL8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5EBL8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5EBL8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5EBL8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5EBL8

PeptideAtlas

More...
PeptideAtlasi
Q5EBL8

PRoteomics IDEntifications database

More...
PRIDEi
Q5EBL8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62764 [Q5EBL8-1]
62765 [Q5EBL8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5EBL8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5EBL8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120509, Expressed in substantia nigra and 214 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5EBL8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000120509, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ATP2B1, ATP2B2, ATP2B3, ATP2B4 and ATP7A (PubMed:12763866, PubMed:16051599).

Interacts with PLEKHA7 (via WW domains) at zonula adherens; this interaction is essential for the interaction between PLEKHA7 and the ADAM10-binding protein TSPAN33 (PubMed:30463011).

Interacts with SLC5A6 (PubMed:21183659).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119405, 28 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q5EBL8

Protein interaction database and analysis system

More...
IntActi
Q5EBL8, 22 interactors

Molecular INTeraction database

More...
MINTi
Q5EBL8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000239666

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5EBL8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5EBL8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini47 – 129PDZPROSITE-ProRule annotationAdd BLAST83

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3528, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153222

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_133335_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5EBL8

Identification of Orthologs from Complete Genome Data

More...
OMAi
AWIPPQD

Database of Orthologous Groups

More...
OrthoDBi
1530562at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5EBL8

TreeFam database of animal gene trees

More...
TreeFami
TF318964

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478, PDZ
IPR036034, PDZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595, PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228, PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156, SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106, PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q5EBL8-1) [UniParc]FASTAAdd to basket
Also known as: AIPP1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL
60 70 80 90 100
KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV
110 120 130 140
DFQDIEHSKA VEILKTAREI SMRVRFFPYN YHRQKERTVH
Length:140
Mass (Da):16,131
Last modified:August 16, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i601216B821A36DCE
GO
Isoform 2 (identifier: Q5EBL8-2) [UniParc]FASTAAdd to basket
Also known as: AIPP1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGWSCCLKLAGLLSLLNHFLSVLIHSSRALPE

Show »
Length:171
Mass (Da):19,492
Checksum:iE17B82B685BD28F8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06942281S → Y1 PublicationCorresponds to variant dbSNP:rs1245281228Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0150771M → MGWSCCLKLAGLLSLLNHFL SVLIHSSRALPE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF151061 mRNA Translation: AAF36147.1
AY358829 mRNA Translation: AAQ89188.1
AK024746 mRNA No translation available.
CR457149 mRNA Translation: CAG33430.1
BX537725 mRNA Translation: CAD97820.1
AL357752 Genomic DNA No translation available.
CH471132 Genomic DNA Translation: EAX05345.1
CH471132 Genomic DNA Translation: EAX05346.1
BC012996 mRNA Translation: AAH12996.1
BC089433 mRNA Translation: AAH89433.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14400.1 [Q5EBL8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057568.1, NM_016484.4 [Q5EBL8-1]
XP_011529275.1, XM_011530973.2
XP_016885057.1, XM_017029568.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000239666; ENSP00000239666; ENSG00000120509 [Q5EBL8-1]
ENST00000374454; ENSP00000363578; ENSG00000120509 [Q5EBL8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51248

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51248

UCSC genome browser

More...
UCSCi
uc004dyd.2, human [Q5EBL8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151061 mRNA Translation: AAF36147.1
AY358829 mRNA Translation: AAQ89188.1
AK024746 mRNA No translation available.
CR457149 mRNA Translation: CAG33430.1
BX537725 mRNA Translation: CAD97820.1
AL357752 Genomic DNA No translation available.
CH471132 Genomic DNA Translation: EAX05345.1
CH471132 Genomic DNA Translation: EAX05346.1
BC012996 mRNA Translation: AAH12996.1
BC089433 mRNA Translation: AAH89433.1
CCDSiCCDS14400.1 [Q5EBL8-1]
RefSeqiNP_057568.1, NM_016484.4 [Q5EBL8-1]
XP_011529275.1, XM_011530973.2
XP_016885057.1, XM_017029568.1

3D structure databases

SMRiQ5EBL8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi119405, 28 interactors
CORUMiQ5EBL8
IntActiQ5EBL8, 22 interactors
MINTiQ5EBL8
STRINGi9606.ENSP00000239666

PTM databases

iPTMnetiQ5EBL8
PhosphoSitePlusiQ5EBL8

Genetic variation databases

BioMutaiPDZD11
DMDMi73621365

Proteomic databases

EPDiQ5EBL8
jPOSTiQ5EBL8
MassIVEiQ5EBL8
MaxQBiQ5EBL8
PaxDbiQ5EBL8
PeptideAtlasiQ5EBL8
PRIDEiQ5EBL8
ProteomicsDBi62764 [Q5EBL8-1]
62765 [Q5EBL8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
581, 71 antibodies

The DNASU plasmid repository

More...
DNASUi
51248

Genome annotation databases

EnsembliENST00000239666; ENSP00000239666; ENSG00000120509 [Q5EBL8-1]
ENST00000374454; ENSP00000363578; ENSG00000120509 [Q5EBL8-1]
GeneIDi51248
KEGGihsa:51248
UCSCiuc004dyd.2, human [Q5EBL8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51248

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDZD11
HGNCiHGNC:28034, PDZD11
HPAiENSG00000120509, Low tissue specificity
MIMi300632, gene
neXtProtiNX_Q5EBL8
OpenTargetsiENSG00000120509
PharmGKBiPA134968632
VEuPathDBiHostDB:ENSG00000120509.10

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3528, Eukaryota
GeneTreeiENSGT00940000153222
HOGENOMiCLU_133335_0_0_1
InParanoidiQ5EBL8
OMAiAWIPPQD
OrthoDBi1530562at2759
PhylomeDBiQ5EBL8
TreeFamiTF318964

Enzyme and pathway databases

PathwayCommonsiQ5EBL8
ReactomeiR-HSA-196780, Biotin transport and metabolism
R-HSA-199220, Vitamin B5 (pantothenate) metabolism
R-HSA-425397, Transport of vitamins, nucleosides, and related molecules
R-HSA-6803544, Ion influx/efflux at host-pathogen interface
R-HSA-936837, Ion transport by P-type ATPases
SIGNORiQ5EBL8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
51248, 12 hits in 632 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDZD11, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PDZD11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51248
PharosiQ5EBL8, Tbio

Protein Ontology

More...
PROi
PR:Q5EBL8
RNActiQ5EBL8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120509, Expressed in substantia nigra and 214 other tissues
GenevisibleiQ5EBL8, HS

Family and domain databases

Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR001478, PDZ
IPR036034, PDZ_sf
PfamiView protein in Pfam
PF00595, PDZ, 1 hit
SMARTiView protein in SMART
SM00228, PDZ, 1 hit
SUPFAMiSSF50156, SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106, PDZ, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDZ11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5EBL8
Secondary accession number(s): D3DVU3, Q6UWE1, Q9P0Q1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: June 2, 2021
This is version 149 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again