Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q5EBL4 (RIPL1_HUMAN)

Entry version 126 (07 Apr 2021)
Sequence version 1 (15 Mar 2005)
Previous versions | rss
Add a publicationFeedback
Protein

RILP-like protein 1

Gene

RILPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the regulation of cell shape and polarity (By similarity). Plays a role in cellular protein transport, including protein transport away from primary cilia (By similarity). Neuroprotective protein, which acts by sequestring GAPDH in the cytosol and prevent the apoptotic function of GAPDH in the nucleus (By similarity). Competes with SIAH1 for binding GAPDH (By similarity). Does not regulate lysosomal morphology and distribution (PubMed:14668488). Binds to RAB10 following LRRK2-mediated RAB10 phosphorylation which leads to inhibition of ciliogenesis (PubMed:30398148).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q5EBL4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RILP-like protein 1
Alternative name(s):
Rab-interacting lysosomal-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RILPL1
Synonyms:RLP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26814, RILPL1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614092, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q5EBL4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000188026.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi291R → L or E: Loss of interaction with RAB8A and RAB10. 1 Publication1
Mutagenesisi293R → L or E: Loss of interaction with RAB8A. 1 Publication1
Mutagenesisi300R → L or E: No loss of interaction with RAB8A. 1 Publication1
Mutagenesisi310K → L or E: Loss of interaction with RAB8A. 1 Publication1
Mutagenesisi324K → L or E: No loss of interaction with RAB8A. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		353116

Open Targets

More...OpenTargetsi		ENSG00000188026

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162401302

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q5EBL4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RILPL1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74736071

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002993101 – 403RILP-like protein 1Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei7PhosphoserineBy similarity1
Modified residuei47S-nitrosocysteineBy similarity1
Modified residuei259PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

S-nitrosylation is required for the interaction with GAPDH.By similarity

Keywords - PTMi

Phosphoprotein, S-nitrosylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q5EBL4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q5EBL4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q5EBL4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q5EBL4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q5EBL4

PeptideAtlas

More...PeptideAtlasi		Q5EBL4

PRoteomics IDEntifications database

More...PRIDEi		Q5EBL4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		62761 [Q5EBL4-1]
62762 [Q5EBL4-2]
62763 [Q5EBL4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q5EBL4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q5EBL4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at lower level in liver and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000188026, Expressed in apex of heart and 116 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q5EBL4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q5EBL4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000188026, Group enriched (brain, heart muscle, skeletal muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (when S-nitrosylated) with GAPDH (By similarity).

Interacts with RAB8A; interaction is dependent on the phosphorylation of 'Thr-72' of RAB8A (PubMed:29125462, PubMed:30398148).

Interacts with RAB10 and RAB12; the interaction is dependent on the phosphorylation of 'Thr-73' of RAB10, and 'Ser-105' of RAB12 (PubMed:29125462, PubMed:30398148).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		131631, 11 interactors

Protein interaction database and analysis system

More...IntActi		Q5EBL4, 12 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000366070

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q5EBL4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q5EBL4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini10 – 97RH1PROSITE-ProRule annotationAdd BLAST88
Domaini291 – 356RH2PROSITE-ProRule annotationAdd BLAST66

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili76 – 258Sequence analysisAdd BLAST183

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RILPL family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QR9G, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157897

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_044133_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q5EBL4

Identification of Orthologs from Complete Genome Data

More...OMAi		SEKMAMD

Database of Orthologous Groups

More...OrthoDBi		890179at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q5EBL4

TreeFam database of animal gene trees

More...TreeFami		TF313489

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019143, JNK/Rab-associated_protein-1_N
IPR034743, RH1
IPR034744, RH2
IPR021563, RILP_dimer

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09744, Jnk-SapK_ap_N, 1 hit
PF11461, RILP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51776, RH1, 1 hit
PS51777, RH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5EBL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEERGSALA AESALEKNVA ELTVMDVYDI ASLVGHEFER VIDQHGCEAI 
        60         70         80         90        100
ARLMPKVVRV LEILEVLVSR HHVAPELDEL RLELDRLRLE RMDRIEKERK 
       110        120        130        140        150
HQKELELVED VWRGEAQDLL SQIAQLQEEN KQLMTNLSHK DVNFSEEEFQ 
       160        170        180        190        200
KHEGMSERER QVMKKLKEVV DKQRDEIRAK DRELGLKNED VEALQQQQTR 
       210        220        230        240        250
LMKINHDLRH RVTVVEAQGK ALIEQKVELE ADLQTKEQEM GSLRAELGKL 
       260        270        280        290        300
RERLQGEHSQ NGEEEPETEP VGEESISDAE KVAMDLKDPN RPRFTLQELR 
       310        320        330        340        350
DVLHERNELK SKVFLLQEEL AYYKSEEMEE ENRIPQPPPI AHPRTSPQPE 
       360        370        380        390        400
SGIKRLFSFF SRDKKRLANT QRNVHIQESF GQWANTHRDD GYTEQGQEAL 

QHL
Length:403
Mass (Da):47,108
Last modified:March 15, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i907F7120DE1C8D29
GO
Isoform 2 (identifier: Q5EBL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: Missing.
     357-403: FSFFSRDKKR...EQGQEALQHL → IFTAIMPMVAAGLIIDDPTLQPVRRLVSLV

Show »
Length:362
Mass (Da):42,236
Checksum:iE7184472F0F6DD17
GO
Isoform 3 (identifier: Q5EBL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     152-153: HE → MT

Show »
Length:252
Mass (Da):29,468
Checksum:iBA5E51C86CCDF67B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GVV3A0A1B0GVV3_HUMAN
RILP-like protein 1
RILPL1
386Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0276051 – 151Missing in isoform 3. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0276061 – 24Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_027607152 – 153HE → MT in isoform 3. 1 Publication2
Alternative sequenceiVSP_027608357 – 403FSFFS…ALQHL → IFTAIMPMVAAGLIIDDPTL QPVRRLVSLV in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK096697 mRNA Translation: BAC04845.1
AC055713 Genomic DNA No translation available.
AC145423 Genomic DNA No translation available.
BC080626 mRNA Translation: AAH80626.1
BC089444 mRNA Translation: AAH89444.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45006.1 [Q5EBL4-1]

NCBI Reference Sequences

More...RefSeqi		NP_001306172.1, NM_001319243.1
NP_001306173.1, NM_001319244.1 [Q5EBL4-3]
NP_001306231.1, NM_001319302.1 [Q5EBL4-3]
NP_847884.2, NM_178314.4 [Q5EBL4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000376874; ENSP00000366070; ENSG00000188026 [Q5EBL4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		353116

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:353116

UCSC genome browser

More...UCSCi		uc001ufe.3, human [Q5EBL4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096697 mRNA Translation: BAC04845.1
AC055713 Genomic DNA No translation available.
AC145423 Genomic DNA No translation available.
BC080626 mRNA Translation: AAH80626.1
BC089444 mRNA Translation: AAH89444.1
CCDSiCCDS45006.1 [Q5EBL4-1]
RefSeqiNP_001306172.1, NM_001319243.1
NP_001306173.1, NM_001319244.1 [Q5EBL4-3]
NP_001306231.1, NM_001319302.1 [Q5EBL4-3]
NP_847884.2, NM_178314.4 [Q5EBL4-1]

3D structure databases

SMRiQ5EBL4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi131631, 11 interactors
IntActiQ5EBL4, 12 interactors
STRINGi9606.ENSP00000366070

PTM databases

iPTMnetiQ5EBL4
PhosphoSitePlusiQ5EBL4

Genetic variation databases

BioMutaiRILPL1
DMDMi74736071

Proteomic databases

EPDiQ5EBL4
jPOSTiQ5EBL4
MassIVEiQ5EBL4
MaxQBiQ5EBL4
PaxDbiQ5EBL4
PeptideAtlasiQ5EBL4
PRIDEiQ5EBL4
ProteomicsDBi62761 [Q5EBL4-1]
62762 [Q5EBL4-2]
62763 [Q5EBL4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31816, 99 antibodies

The DNASU plasmid repository

More...DNASUi		353116

Genome annotation databases

EnsembliENST00000376874; ENSP00000366070; ENSG00000188026 [Q5EBL4-1]
GeneIDi353116
KEGGihsa:353116
UCSCiuc001ufe.3, human [Q5EBL4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		353116
DisGeNETi353116

GeneCards: human genes, protein and diseases

More...GeneCardsi		RILPL1
HGNCiHGNC:26814, RILPL1
HPAiENSG00000188026, Group enriched (brain, heart muscle, skeletal muscle)
MIMi614092, gene
neXtProtiNX_Q5EBL4
OpenTargetsiENSG00000188026
PharmGKBiPA162401302
VEuPathDBiHostDB:ENSG00000188026.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QR9G, Eukaryota
GeneTreeiENSGT00940000157897
HOGENOMiCLU_044133_3_0_1
InParanoidiQ5EBL4
OMAiSEKMAMD
OrthoDBi890179at2759
PhylomeDBiQ5EBL4
TreeFamiTF313489

Enzyme and pathway databases

PathwayCommonsiQ5EBL4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		353116, 19 hits in 1001 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RILPL1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		353116
PharosiQ5EBL4, Tbio

Protein Ontology

More...PROi		PR:Q5EBL4
RNActiQ5EBL4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000188026, Expressed in apex of heart and 116 other tissues
ExpressionAtlasiQ5EBL4, baseline and differential
GenevisibleiQ5EBL4, HS

Family and domain databases

InterProiView protein in InterPro
IPR019143, JNK/Rab-associated_protein-1_N
IPR034743, RH1
IPR034744, RH2
IPR021563, RILP_dimer
PfamiView protein in Pfam
PF09744, Jnk-SapK_ap_N, 1 hit
PF11461, RILP, 1 hit
PROSITEiView protein in PROSITE
PS51776, RH1, 1 hit
PS51777, RH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIPL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5EBL4
Secondary accession number(s): Q66K36, Q8N1M0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 15, 2005
Last modified: April 7, 2021
This is version 126 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again