Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (22 Apr 2020)
Sequence version 1 (27 Sep 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein YIF1B

Gene

YIF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the anterograde traffic pathway from the endoplasmic reticulum to the plasma membrane and the organization of the Golgi architecture (By similarity). Plays a key role in targeting to neuronal dendrites receptors such as HTR1A (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein YIF1BCurated
Alternative name(s):
YIP1-interacting factor homolog B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:YIF1BImported
ORF Names:PP4519, UNQ3073/PRO9905
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30511 YIF1B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5BJH7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 156CytoplasmicSequence analysisAdd BLAST156
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 192ExtracellularSequence analysisAdd BLAST15
Transmembranei193 – 213HelicalSequence analysisAdd BLAST21
Topological domaini214 – 219CytoplasmicSequence analysis6
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Topological domaini241ExtracellularSequence analysis1
Transmembranei242 – 262HelicalSequence analysisAdd BLAST21
Topological domaini263 – 292CytoplasmicSequence analysisAdd BLAST30
Transmembranei293 – 313HelicalSequence analysisAdd BLAST21
Topological domaini314ExtracellularSequence analysis1

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
90522

Open Targets

More...
OpenTargetsi
ENSG00000167645

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670561

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q5BJH7 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
YIF1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121944384

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003072581 – 314Protein YIF1BAdd BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei13PhosphothreonineBy similarity1
Modified residuei65PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5BJH7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q5BJH7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q5BJH7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5BJH7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5BJH7

PeptideAtlas

More...
PeptideAtlasi
Q5BJH7

PRoteomics IDEntifications database

More...
PRIDEi
Q5BJH7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
43383
62693 [Q5BJH7-1]
62694 [Q5BJH7-2]
62695 [Q5BJH7-3]
62696 [Q5BJH7-4]
62697 [Q5BJH7-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5BJH7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5BJH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167645 Expressed in amniotic fluid and 180 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5BJH7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5BJH7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000167645 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HTR1A (via C-terminus).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124728, 14 interactors

Protein interaction database and analysis system

More...
IntActi
Q5BJH7, 15 interactors

Molecular INTeraction database

More...
MINTi
Q5BJH7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000343435

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q5BJH7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the YIF1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3094 Eukaryota
COG5197 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009423

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5BJH7

KEGG Orthology (KO)

More...
KOi
K20362

Identification of Orthologs from Complete Genome Data

More...
OMAi
EGWYLPP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5BJH7

TreeFam database of animal gene trees

More...
TreeFami
TF314528

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005578 Yif1_fam

The PANTHER Classification System

More...
PANTHERi
PTHR14083 PTHR14083, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03878 YIF1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5BJH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY
60 70 80 90 100
GAQRAPGGLS YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI
110 120 130 140 150
DRFIPITKLK YYFAVDTMYV GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF
160 170 180 190 200
DVNAPDLYIP AMAFITYVLV AGLALGTQDR FSPDLLGLQA SSALAWLTLE
210 220 230 240 250
VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG LLFGKIGYYL
260 270 280 290 300
VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA
310
QPMLMYWLTF HLVR
Length:314
Mass (Da):34,435
Last modified:September 27, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i93A2521A3332D3AD
GO
Isoform 2 (identifier: Q5BJH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:283
Mass (Da):31,175
Checksum:iF68245FE42608C59
GO
Isoform 3 (identifier: Q5BJH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.

Show »
Length:311
Mass (Da):33,965
Checksum:i006B7C3F190E281E
GO
Isoform 4 (identifier: Q5BJH7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
     295-314: Missing.

Show »
Length:291
Mass (Da):31,245
Checksum:i76319390816EF13F
GO
Isoform 5 (identifier: Q5BJH7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
     298-314: Missing.

Show »
Length:294
Mass (Da):31,579
Checksum:i3ADFF564F9ED3081
GO
Isoform 6 (identifier: Q5BJH7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA

Show »
Length:299
Mass (Da):32,825
Checksum:iD2B3DA4653839855
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ERY2K7ERY2_HUMAN
Protein YIF1B
YIF1B
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPQ7K7EPQ7_HUMAN
Protein YIF1B
YIF1B
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERQ0K7ERQ0_HUMAN
Protein YIF1B
YIF1B
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJQ6K7EJQ6_HUMAN
Protein YIF1B
YIF1B
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03538556P → S. Corresponds to variant dbSNP:rs11556992Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0286501 – 31Missing in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0468231 – 20MHPAG…LRKWP → MPGSA in isoform 6. CuratedAdd BLAST20
Alternative sequenceiVSP_02865117 – 19Missing in isoform 3, isoform 4 and isoform 5. 2 Publications3
Alternative sequenceiVSP_028652264 – 297IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_028653264 – 294IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_028654295 – 314Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_028655298 – 314Missing in isoform 5. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358965 mRNA Translation: AAQ89324.1
AF258578 mRNA Translation: AAG23781.1
AL833382 mRNA Translation: CAI46138.1
AC011479 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56772.1
BC007644 mRNA Translation: AAH07644.1
BC014974 mRNA Translation: AAH14974.1
BC091477 mRNA Translation: AAH91477.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12512.1 [Q5BJH7-2]
CCDS33010.1 [Q5BJH7-1]
CCDS46066.1 [Q5BJH7-6]
CCDS46067.1 [Q5BJH7-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001034761.1, NM_001039672.2 [Q5BJH7-1]
NP_001034762.1, NM_001039673.2 [Q5BJH7-3]
NP_001138934.1, NM_001145462.1 [Q5BJH7-2]
NP_001138935.1, NM_001145463.1 [Q5BJH7-4]
XP_005259442.1, XM_005259385.3 [Q5BJH7-2]
XP_016882938.1, XM_017027449.1 [Q5BJH7-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329420; ENSP00000329559; ENSG00000167645 [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645 [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645 [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645 [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645 [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645 [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645 [Q5BJH7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90522

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90522

UCSC genome browser

More...
UCSCi
uc002ohw.3 human [Q5BJH7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358965 mRNA Translation: AAQ89324.1
AF258578 mRNA Translation: AAG23781.1
AL833382 mRNA Translation: CAI46138.1
AC011479 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56772.1
BC007644 mRNA Translation: AAH07644.1
BC014974 mRNA Translation: AAH14974.1
BC091477 mRNA Translation: AAH91477.2
CCDSiCCDS12512.1 [Q5BJH7-2]
CCDS33010.1 [Q5BJH7-1]
CCDS46066.1 [Q5BJH7-6]
CCDS46067.1 [Q5BJH7-4]
RefSeqiNP_001034761.1, NM_001039672.2 [Q5BJH7-1]
NP_001034762.1, NM_001039673.2 [Q5BJH7-3]
NP_001138934.1, NM_001145462.1 [Q5BJH7-2]
NP_001138935.1, NM_001145463.1 [Q5BJH7-4]
XP_005259442.1, XM_005259385.3 [Q5BJH7-2]
XP_016882938.1, XM_017027449.1 [Q5BJH7-5]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124728, 14 interactors
IntActiQ5BJH7, 15 interactors
MINTiQ5BJH7
STRINGi9606.ENSP00000343435

PTM databases

iPTMnetiQ5BJH7
PhosphoSitePlusiQ5BJH7

Polymorphism and mutation databases

BioMutaiYIF1B
DMDMi121944384

Proteomic databases

EPDiQ5BJH7
jPOSTiQ5BJH7
MassIVEiQ5BJH7
MaxQBiQ5BJH7
PaxDbiQ5BJH7
PeptideAtlasiQ5BJH7
PRIDEiQ5BJH7
ProteomicsDBi43383
62693 [Q5BJH7-1]
62694 [Q5BJH7-2]
62695 [Q5BJH7-3]
62696 [Q5BJH7-4]
62697 [Q5BJH7-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30011 112 antibodies

The DNASU plasmid repository

More...
DNASUi
90522

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645 [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645 [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645 [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645 [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645 [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645 [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645 [Q5BJH7-2]
GeneIDi90522
KEGGihsa:90522
UCSCiuc002ohw.3 human [Q5BJH7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90522
DisGeNETi90522

GeneCards: human genes, protein and diseases

More...
GeneCardsi
YIF1B
HGNCiHGNC:30511 YIF1B
HPAiENSG00000167645 Low tissue specificity
neXtProtiNX_Q5BJH7
OpenTargetsiENSG00000167645
PharmGKBiPA142670561

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3094 Eukaryota
COG5197 LUCA
GeneTreeiENSGT00390000009423
InParanoidiQ5BJH7
KOiK20362
OMAiEGWYLPP
PhylomeDBiQ5BJH7
TreeFamiTF314528

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
YIF1B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90522
PharosiQ5BJH7 Tbio

Protein Ontology

More...
PROi
PR:Q5BJH7
RNActiQ5BJH7 protein

Gene expression databases

BgeeiENSG00000167645 Expressed in amniotic fluid and 180 other tissues
ExpressionAtlasiQ5BJH7 baseline and differential
GenevisibleiQ5BJH7 HS

Family and domain databases

InterProiView protein in InterPro
IPR005578 Yif1_fam
PANTHERiPTHR14083 PTHR14083, 1 hit
PfamiView protein in Pfam
PF03878 YIF1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiYIF1B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5BJH7
Secondary accession number(s): H7BXS8
, Q5JPC2, Q8WY70, Q96C02, Q96IC4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: September 27, 2005
Last modified: April 22, 2020
This is version 112 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again