Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein YIF1B

Gene

YIF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Protein YIF1B
Alternative name(s):
YIP1-interacting factor homolog B
Gene namesi
Name:YIF1B
ORF Names:PP4519, UNQ3073/PRO9905
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000167645.16
HGNCiHGNC:30511 YIF1B
neXtProtiNX_Q5BJH7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 156CytoplasmicSequence analysisAdd BLAST156
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 192ExtracellularSequence analysisAdd BLAST15
Transmembranei193 – 213HelicalSequence analysisAdd BLAST21
Topological domaini214 – 219CytoplasmicSequence analysis6
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Topological domaini241ExtracellularSequence analysis1
Transmembranei242 – 262HelicalSequence analysisAdd BLAST21
Topological domaini263 – 292CytoplasmicSequence analysisAdd BLAST30
Transmembranei293 – 313HelicalSequence analysisAdd BLAST21
Topological domaini314ExtracellularSequence analysis1

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167645
PharmGKBiPA142670561

Polymorphism and mutation databases

BioMutaiYIF1B
DMDMi121944384

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003072581 – 314Protein YIF1BAdd BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei13PhosphothreonineBy similarity1
Modified residuei65PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ5BJH7
MaxQBiQ5BJH7
PaxDbiQ5BJH7
PeptideAtlasiQ5BJH7
PRIDEiQ5BJH7
ProteomicsDBi62693
62694 [Q5BJH7-2]
62695 [Q5BJH7-3]
62696 [Q5BJH7-4]
62697 [Q5BJH7-5]

PTM databases

iPTMnetiQ5BJH7
PhosphoSitePlusiQ5BJH7

Expressioni

Gene expression databases

BgeeiENSG00000167645 Expressed in 181 organ(s), highest expression level in amniotic fluid
CleanExiHS_YIF1B
ExpressionAtlasiQ5BJH7 baseline and differential
GenevisibleiQ5BJH7 HS

Organism-specific databases

HPAiHPA039328
HPA055257
HPA062675

Interactioni

Protein-protein interaction databases

BioGridi124728, 13 interactors
IntActiQ5BJH7, 6 interactors
MINTiQ5BJH7
STRINGi9606.ENSP00000343435

Structurei

3D structure databases

ProteinModelPortaliQ5BJH7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the YIF1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3094 Eukaryota
COG5197 LUCA
GeneTreeiENSGT00390000009423
HOGENOMiHOG000234333
HOVERGENiHBG053252
InParanoidiQ5BJH7
KOiK20362
OMAiKWPSKRR
OrthoDBiEOG091G0H35
PhylomeDBiQ5BJH7
TreeFamiTF314528

Family and domain databases

InterProiView protein in InterPro
IPR005578 Yif1_fam
PANTHERiPTHR14083 PTHR14083, 1 hit
PfamiView protein in Pfam
PF03878 YIF1, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5BJH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHPAGLAAAA AGTPRLRKWP SKRRIPVSQP GMADPHQLFD DTSSAQSRGY
60 70 80 90 100
GAQRAPGGLS YPAASPTPHA AFLADPVSNM AMAYGSSLAA QGKELVDKNI
110 120 130 140 150
DRFIPITKLK YYFAVDTMYV GRKLGLLFFP YLHQDWEVQY QQDTPVAPRF
160 170 180 190 200
DVNAPDLYIP AMAFITYVLV AGLALGTQDR FSPDLLGLQA SSALAWLTLE
210 220 230 240 250
VLAILLSLYL VTVNTDLTTI DLVAFLGYKY VGMIGGVLMG LLFGKIGYYL
260 270 280 290 300
VLGWCCVAIF VFMIRTLRLK ILADAAAEGV PVRGARNQLR MYLTMAVAAA
310
QPMLMYWLTF HLVR
Length:314
Mass (Da):34,435
Last modified:September 27, 2005 - v1
Checksum:i93A2521A3332D3AD
GO
Isoform 2 (identifier: Q5BJH7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: Missing.

Show »
Length:283
Mass (Da):31,175
Checksum:iF68245FE42608C59
GO
Isoform 3 (identifier: Q5BJH7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.

Show »
Length:311
Mass (Da):33,965
Checksum:i006B7C3F190E281E
GO
Isoform 4 (identifier: Q5BJH7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-294: IRTLRLKILADAAAEGVPVRGARNQLRMYLT → FPLLPGAVAHACNPSTLGGRGGRITRSGRCG
     295-314: Missing.

Show »
Length:291
Mass (Da):31,245
Checksum:i76319390816EF13F
GO
Isoform 5 (identifier: Q5BJH7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     17-19: Missing.
     264-297: IRTLRLKILADAAAEGVPVRGARNQLRMYLTMAV → FPLLPGAVAHACNPSTLGGRGGRITRSGDQDHPG
     298-314: Missing.

Note: No experimental confirmation available.
Show »
Length:294
Mass (Da):31,579
Checksum:i3ADFF564F9ED3081
GO
Isoform 6 (identifier: Q5BJH7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MHPAGLAAAAAGTPRLRKWP → MPGSA

Note: Gene prediction based on EST data.
Show »
Length:299
Mass (Da):32,825
Checksum:iD2B3DA4653839855
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EPQ7K7EPQ7_HUMAN
Protein YIF1B
YIF1B
248Annotation score:
K7ERY2K7ERY2_HUMAN
Protein YIF1B
YIF1B
231Annotation score:
K7ERQ0K7ERQ0_HUMAN
Protein YIF1B
YIF1B
192Annotation score:
K7EJQ6K7EJQ6_HUMAN
Protein YIF1B
YIF1B
103Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03538556P → S. Corresponds to variant dbSNP:rs11556992Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0286501 – 31Missing in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0468231 – 20MHPAG…LRKWP → MPGSA in isoform 6. CuratedAdd BLAST20
Alternative sequenceiVSP_02865117 – 19Missing in isoform 3, isoform 4 and isoform 5. 2 Publications3
Alternative sequenceiVSP_028652264 – 297IRTLR…LTMAV → FPLLPGAVAHACNPSTLGGR GGRITRSGDQDHPG in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_028653264 – 294IRTLR…RMYLT → FPLLPGAVAHACNPSTLGGR GGRITRSGRCG in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_028654295 – 314Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_028655298 – 314Missing in isoform 5. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358965 mRNA Translation: AAQ89324.1
AF258578 mRNA Translation: AAG23781.1
AL833382 mRNA Translation: CAI46138.1
AC011479 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56772.1
BC007644 mRNA Translation: AAH07644.1
BC014974 mRNA Translation: AAH14974.1
BC091477 mRNA Translation: AAH91477.2
CCDSiCCDS12512.1 [Q5BJH7-2]
CCDS33010.1 [Q5BJH7-1]
CCDS46066.1 [Q5BJH7-6]
CCDS46067.1 [Q5BJH7-4]
RefSeqiNP_001034761.1, NM_001039672.2 [Q5BJH7-1]
NP_001034762.1, NM_001039673.2 [Q5BJH7-3]
NP_001138934.1, NM_001145462.1 [Q5BJH7-2]
NP_001138935.1, NM_001145463.1 [Q5BJH7-4]
XP_005259442.1, XM_005259385.3 [Q5BJH7-2]
XP_016882938.1, XM_017027449.1 [Q5BJH7-5]
UniGeneiHs.280741

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645 [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645 [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645 [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645 [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645 [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645 [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645 [Q5BJH7-2]
GeneIDi90522
KEGGihsa:90522
UCSCiuc002ohw.3 human [Q5BJH7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358965 mRNA Translation: AAQ89324.1
AF258578 mRNA Translation: AAG23781.1
AL833382 mRNA Translation: CAI46138.1
AC011479 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW56772.1
BC007644 mRNA Translation: AAH07644.1
BC014974 mRNA Translation: AAH14974.1
BC091477 mRNA Translation: AAH91477.2
CCDSiCCDS12512.1 [Q5BJH7-2]
CCDS33010.1 [Q5BJH7-1]
CCDS46066.1 [Q5BJH7-6]
CCDS46067.1 [Q5BJH7-4]
RefSeqiNP_001034761.1, NM_001039672.2 [Q5BJH7-1]
NP_001034762.1, NM_001039673.2 [Q5BJH7-3]
NP_001138934.1, NM_001145462.1 [Q5BJH7-2]
NP_001138935.1, NM_001145463.1 [Q5BJH7-4]
XP_005259442.1, XM_005259385.3 [Q5BJH7-2]
XP_016882938.1, XM_017027449.1 [Q5BJH7-5]
UniGeneiHs.280741

3D structure databases

ProteinModelPortaliQ5BJH7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124728, 13 interactors
IntActiQ5BJH7, 6 interactors
MINTiQ5BJH7
STRINGi9606.ENSP00000343435

PTM databases

iPTMnetiQ5BJH7
PhosphoSitePlusiQ5BJH7

Polymorphism and mutation databases

BioMutaiYIF1B
DMDMi121944384

Proteomic databases

EPDiQ5BJH7
MaxQBiQ5BJH7
PaxDbiQ5BJH7
PeptideAtlasiQ5BJH7
PRIDEiQ5BJH7
ProteomicsDBi62693
62694 [Q5BJH7-2]
62695 [Q5BJH7-3]
62696 [Q5BJH7-4]
62697 [Q5BJH7-5]

Protocols and materials databases

DNASUi90522
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329420; ENSP00000329559; ENSG00000167645 [Q5BJH7-6]
ENST00000337679; ENSP00000337411; ENSG00000167645 [Q5BJH7-4]
ENST00000339413; ENSP00000343435; ENSG00000167645 [Q5BJH7-1]
ENST00000392124; ENSP00000375971; ENSG00000167645 [Q5BJH7-2]
ENST00000591755; ENSP00000465446; ENSG00000167645 [Q5BJH7-5]
ENST00000591784; ENSP00000465230; ENSG00000167645 [Q5BJH7-2]
ENST00000592694; ENSP00000466428; ENSG00000167645 [Q5BJH7-2]
GeneIDi90522
KEGGihsa:90522
UCSCiuc002ohw.3 human [Q5BJH7-1]

Organism-specific databases

CTDi90522
EuPathDBiHostDB:ENSG00000167645.16
GeneCardsiYIF1B
HGNCiHGNC:30511 YIF1B
HPAiHPA039328
HPA055257
HPA062675
neXtProtiNX_Q5BJH7
OpenTargetsiENSG00000167645
PharmGKBiPA142670561
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3094 Eukaryota
COG5197 LUCA
GeneTreeiENSGT00390000009423
HOGENOMiHOG000234333
HOVERGENiHBG053252
InParanoidiQ5BJH7
KOiK20362
OMAiKWPSKRR
OrthoDBiEOG091G0H35
PhylomeDBiQ5BJH7
TreeFamiTF314528

Miscellaneous databases

ChiTaRSiYIF1B human
GenomeRNAii90522
PROiPR:Q5BJH7

Gene expression databases

BgeeiENSG00000167645 Expressed in 181 organ(s), highest expression level in amniotic fluid
CleanExiHS_YIF1B
ExpressionAtlasiQ5BJH7 baseline and differential
GenevisibleiQ5BJH7 HS

Family and domain databases

InterProiView protein in InterPro
IPR005578 Yif1_fam
PANTHERiPTHR14083 PTHR14083, 1 hit
PfamiView protein in Pfam
PF03878 YIF1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiYIF1B_HUMAN
AccessioniPrimary (citable) accession number: Q5BJH7
Secondary accession number(s): H7BXS8
, Q5JPC2, Q8WY70, Q96C02, Q96IC4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: September 27, 2005
Last modified: September 12, 2018
This is version 102 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again