Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Outer dense fiber protein 2

Gene

ODF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • Rab GTPase binding Source: UniProtKB
  • structural molecule activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-8854518 AURKA Activation by TPX2

Protein family/group databases

MoonProt database of moonlighting proteins

More...
MoonProti
Q5BJF6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Outer dense fiber protein 2
Alternative name(s):
Cenexin
Outer dense fiber of sperm tails protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ODF2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000136811.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8114 ODF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602015 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q5BJF6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4957

Open Targets

More...
OpenTargetsi
ENSG00000136811

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31902

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ODF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74736013

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002994551 – 829Outer dense fiber protein 2Add BLAST829

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei73PhosphoserineBy similarity1
Modified residuei74PhosphoserineBy similarity1
Modified residuei92PhosphothreonineBy similarity1
Modified residuei95Phosphoserine; by TSSK4By similarity1
Modified residuei106PhosphoserineBy similarity1
Modified residuei109PhosphoserineBy similarity1
Modified residuei110PhosphothreonineBy similarity1
Modified residuei115PhosphoserineBy similarity1
Modified residuei129PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei139PhosphoserineBy similarity1
Modified residuei231PhosphothreonineCombined sources1
Modified residuei261PhosphoserineBy similarity1
Modified residuei632PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Tyrosine phosphorylated. Phosphorylated by TSSK4 on Ser-95.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q5BJF6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q5BJF6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q5BJF6

PeptideAtlas

More...
PeptideAtlasi
Q5BJF6

PRoteomics IDEntifications database

More...
PRIDEi
Q5BJF6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62680
62681 [Q5BJF6-2]
62682 [Q5BJF6-3]
62683 [Q5BJF6-4]
62684 [Q5BJF6-5]
62685 [Q5BJF6-6]
62686 [Q5BJF6-7]
62687 [Q5BJF6-8]
62688 [Q5BJF6-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q5BJF6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q5BJF6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000136811 Expressed in 182 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_ODF2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q5BJF6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q5BJF6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001874
HPA048841

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Self-associates. Associates with microtubules and forms a fibrillar structure partially linked to the microtubule network. Interacts via its C-terminus with PLK1 (PubMed:16966375). Interacts with ODF1 (By similarity). Interacts with MARK4; the interaction is required for localization of ODF2 to centrioles (PubMed:23400999). Interacts with TSSK4 (By similarity).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111010, 131 interactors

Protein interaction database and analysis system

More...
IntActi
Q5BJF6, 120 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361882

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q5BJF6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q5BJF6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili144 – 217Sequence analysisAdd BLAST74
Coiled coili245 – 423Sequence analysisAdd BLAST179
Coiled coili461 – 798Sequence analysisAdd BLAST338

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ODF2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IE8V Eukaryota
ENOG4111XWH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063497

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000246967

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052808

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q5BJF6

KEGG Orthology (KO)

More...
KOi
K16479

Identification of Orthologs from Complete Genome Data

More...
OMAi
NQAHIEV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G13KV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q5BJF6

TreeFam database of animal gene trees

More...
TreeFami
TF328605

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026099 Odf2-rel

The PANTHER Classification System

More...
PANTHERi
PTHR23162 PTHR23162, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q5BJF6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSASSSGGSP RFPSCGKNGV TSLTQKKVLR APCGAPSVTV TKSHKRGMKG
60 70 80 90 100
DTVNVRRSVR VKTKVPWMPP GKSSARPVGC KWENPPHCLE ITPPSSEKLV
110 120 130 140 150
SVMRLSDLST EDDDSGHCKM NRYDKKIDSL MNAVGCLKSE VKMQKGERQM
160 170 180 190 200
AKRFLEERKE ELEEVAHELA ETEHENTVLR HNIERMKEEK DFTILQKKHL
210 220 230 240 250
QQEKECLMSK LVEAEMDGAA AAKQVMALKD TIGKLKTEKQ MTCTDINTLT
260 270 280 290 300
RQKELLLQKL STFEETNRTL RDLLREQHCK EDSERLMEQQ GALLKRLAEA
310 320 330 340 350
DSEKARLLLL LQDKDKEVEE LLQEIQCEKA QAKTASELSK SMESMRGHLQ
360 370 380 390 400
AQLRSKEAEN SRLCMQIKNL ERSGNQHKAE VEAIMEQLKE LKQKGDRDKE
410 420 430 440 450
SLKKAIRAQK ERAEKSEEYA EQLHVQLADK DLYVAEALST LESWRSRYNQ
460 470 480 490 500
VVKEKGDLEL EIIVLNDRVT DLVNQQQTLE EKMREDRDSL VERLHRQTAE
510 520 530 540 550
YSAFKLENER LKASFAPMED KLNQAHLEVQ QLKASVKNYE GMIDNYKSQV
560 570 580 590 600
MKTRLEADEV AAQLERCDKE NKILKDEMNK EIEAARRQFQ SQLADLQQLP
610 620 630 640 650
DILKITEAKL AECQDQLQGY ERKNIDLTAI ISDLRSRIEH QGDKLEMARE
660 670 680 690 700
KHQASQKENK QLSLKVDELE RKLEATSAQN IEFLQVIAKR EEAIHQSQLR
710 720 730 740 750
LEEKTRECGT LARQLESAIE DARRQVEQTK EHALSKERAA QNKILDLETQ
760 770 780 790 800
LSRTKTELSQ LRRSRDDADR RYQSRLQDLK DRLEQSESTN RSMQNYVQFL
810 820
KSSYANVFGD GPYSTFLTSS PIRSRSPPA
Length:829
Mass (Da):95,401
Last modified:April 12, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF49166AD9003BEB
GO
Isoform 2 (identifier: Q5BJF6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     65-83: Missing.

Note: No experimental confirmation available.
Show »
Length:763
Mass (Da):88,578
Checksum:i5055A59E4E74DF9C
GO
Isoform 3 (identifier: Q5BJF6-3) [UniParc]FASTAAdd to basket
Also known as: Cenexin 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-83: Missing.

Show »
Length:805
Mass (Da):93,254
Checksum:i1321EE3AC5FCF622
GO
Isoform 4 (identifier: Q5BJF6-4) [UniParc]FASTAAdd to basket
Also known as: Cenexin 1 variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ

Show »
Length:824
Mass (Da):95,348
Checksum:i166CFD3FA9F93215
GO
Isoform 5 (identifier: Q5BJF6-5) [UniParc]FASTAAdd to basket
Also known as: Cenexin 1, ODF2/1

The sequence of this isoform differs from the canonical sequence as follows:
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Note: Major.
Show »
Length:638
Mass (Da):73,339
Checksum:iB7625F274EDB1EAB
GO
Isoform 6 (identifier: Q5BJF6-6) [UniParc]FASTAAdd to basket
Also known as: Isoform 3, ODF2/2

The sequence of this isoform differs from the canonical sequence as follows:
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:657
Mass (Da):75,433
Checksum:iAC80174E5B017689
GO
Isoform 7 (identifier: Q5BJF6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGELPTGCRKRRRKRGGAAARARLHPPRRLHGTTLASDFNDFIRRRFWAQPCRSW
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:701
Mass (Da):80,886
Checksum:i78681E3A810390B4
GO
Isoform 8 (identifier: Q5BJF6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSASSSGGSPR → MGRNRYPPACW
     65-83: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:638
Mass (Da):73,666
Checksum:iC7C7CFFF669EC468
GO
Isoform 9 (identifier: Q5BJF6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSASSSGGSP...PCGAPSVTVT → MKDRSSTPPL...LPKPSATSSQ
     65-140: Missing.
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Show »
Length:576
Mass (Da):66,967
Checksum:iA8B1A574A75B89E5
GO
Isoform 10 (identifier: Q5BJF6-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MSASSSGGSP → MADQQGPHQN
     638-657: IEHQGDKLEMAREKHQASQK → VRDWQKGSHELTRAGARIPR
     658-829: Missing.

Note: No experimental confirmation available.
Show »
Length:657
Mass (Da):75,691
Checksum:iD01296974EBEA8F5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T4C6Q5T4C6_HUMAN
Outer dense fiber protein 2
ODF2
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3R9S4R3R9_HUMAN
Outer dense fiber protein 2
ODF2
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T4C8Q5T4C8_HUMAN
Outer dense fiber protein 2
ODF2
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T4C3Q5T4C3_HUMAN
Outer dense fiber protein 2
ODF2
386Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R462S4R462_HUMAN
Outer dense fiber protein 2
ODF2
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R411S4R411_HUMAN
Outer dense fiber protein 2
ODF2
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC08409 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti39T → A in AAP83847 (Ref. 3) Curated1
Sequence conflicti194I → R in AAP83847 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034821710T → S. Corresponds to variant dbSNP:rs16930426Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0276651 – 47Missing in isoform 2. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0276661 – 41MSASS…SVTVT → MKDRSSTPPLHVHVDENTPV HVHIKKLPKPSATSSQ in isoform 3, isoform 4 and isoform 9. 3 PublicationsAdd BLAST41
Alternative sequenceiVSP_0420711 – 11MSASSSGGSPR → MGELPTGCRKRRRKRGGAAA RARLHPPRRLHGTTLASDFN DFIRRRFWAQPCRSW in isoform 7. CuratedAdd BLAST11
Alternative sequenceiVSP_0420701 – 11MSASSSGGSPR → MGRNRYPPACW in isoform 8. CuratedAdd BLAST11
Alternative sequenceiVSP_0449461 – 10MSASSSGGSP → MADQQGPHQN in isoform 10. 1 Publication10
Alternative sequenceiVSP_04207265 – 140Missing in isoform 9. CuratedAdd BLAST76
Alternative sequenceiVSP_02766765 – 83Missing in isoform 2, isoform 3, isoform 5 and isoform 8. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_027668638 – 657IEHQG…QASQK → VRDWQKGSHELTRAGARIPR in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsAdd BLAST20
Alternative sequenceiVSP_027669658 – 829Missing in isoform 5, isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10. 3 PublicationsAdd BLAST172

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF012549 mRNA Translation: AAB66337.1
AF053970 mRNA Translation: AAC08409.1 Different initiation.
DQ444713 mRNA Translation: ABE01856.1
DQ444714 mRNA Translation: ABE01857.1
AY319414 mRNA Translation: AAP83847.1
AY366499 mRNA Translation: AAQ73195.1
AK299303 mRNA Translation: BAG61316.1
AK301842 mRNA Translation: BAG63285.1
AK302684 mRNA Translation: BAG63914.1
AL359091 Genomic DNA No translation available.
AL445287 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87791.1
CH471090 Genomic DNA Translation: EAW87793.1
CH471090 Genomic DNA Translation: EAW87795.1
BC091500 mRNA Translation: AAH91500.1
BC010629 mRNA Translation: AAH10629.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56585.1 [Q5BJF6-10]
CCDS56586.1 [Q5BJF6-7]
CCDS56587.1 [Q5BJF6-8]
CCDS56588.1 [Q5BJF6-1]
CCDS56589.1 [Q5BJF6-9]
CCDS56590.1 [Q5BJF6-4]
CCDS6902.1 [Q5BJF6-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T03791

NCBI Reference Sequences

More...
RefSeqi
NP_001229281.1, NM_001242352.1 [Q5BJF6-4]
NP_001229282.1, NM_001242353.1 [Q5BJF6-1]
NP_001229283.1, NM_001242354.1 [Q5BJF6-9]
NP_002531.3, NM_002540.4 [Q5BJF6-3]
NP_702910.1, NM_153432.1 [Q5BJF6-7]
NP_702911.1, NM_153433.1 [Q5BJF6-1]
NP_702913.1, NM_153435.1
NP_702914.1, NM_153436.1 [Q5BJF6-10]
NP_702915.1, NM_153437.2 [Q5BJF6-5]
XP_006717189.1, XM_006717126.3 [Q5BJF6-1]
XP_016870261.1, XM_017014772.1
XP_016870262.1, XM_017014773.1
XP_016870263.1, XM_017014774.1
XP_016870264.1, XM_017014775.1 [Q5BJF6-3]
XP_016870265.1, XM_017014776.1 [Q5BJF6-3]
XP_016870266.1, XM_017014777.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.129055

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000351030; ENSP00000342581; ENSG00000136811 [Q5BJF6-4]
ENST00000372791; ENSP00000361877; ENSG00000136811 [Q5BJF6-5]
ENST00000372807; ENSP00000361893; ENSG00000136811 [Q5BJF6-4]
ENST00000372814; ENSP00000361901; ENSG00000136811 [Q5BJF6-7]
ENST00000393527; ENSP00000377161; ENSG00000136811 [Q5BJF6-3]
ENST00000393533; ENSP00000377166; ENSG00000136811 [Q5BJF6-10]
ENST00000434106; ENSP00000403453; ENSG00000136811 [Q5BJF6-1]
ENST00000444119; ENSP00000394506; ENSG00000136811 [Q5BJF6-3]
ENST00000448249; ENSP00000396687; ENSG00000136811 [Q5BJF6-9]
ENST00000546203; ENSP00000437579; ENSG00000136811 [Q5BJF6-8]
ENST00000604420; ENSP00000473949; ENSG00000136811 [Q5BJF6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4957

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4957

UCSC genome browser

More...
UCSCi
uc004bva.4 human [Q5BJF6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF012549 mRNA Translation: AAB66337.1
AF053970 mRNA Translation: AAC08409.1 Different initiation.
DQ444713 mRNA Translation: ABE01856.1
DQ444714 mRNA Translation: ABE01857.1
AY319414 mRNA Translation: AAP83847.1
AY366499 mRNA Translation: AAQ73195.1
AK299303 mRNA Translation: BAG61316.1
AK301842 mRNA Translation: BAG63285.1
AK302684 mRNA Translation: BAG63914.1
AL359091 Genomic DNA No translation available.
AL445287 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87791.1
CH471090 Genomic DNA Translation: EAW87793.1
CH471090 Genomic DNA Translation: EAW87795.1
BC091500 mRNA Translation: AAH91500.1
BC010629 mRNA Translation: AAH10629.1
CCDSiCCDS56585.1 [Q5BJF6-10]
CCDS56586.1 [Q5BJF6-7]
CCDS56587.1 [Q5BJF6-8]
CCDS56588.1 [Q5BJF6-1]
CCDS56589.1 [Q5BJF6-9]
CCDS56590.1 [Q5BJF6-4]
CCDS6902.1 [Q5BJF6-5]
PIRiT03791
RefSeqiNP_001229281.1, NM_001242352.1 [Q5BJF6-4]
NP_001229282.1, NM_001242353.1 [Q5BJF6-1]
NP_001229283.1, NM_001242354.1 [Q5BJF6-9]
NP_002531.3, NM_002540.4 [Q5BJF6-3]
NP_702910.1, NM_153432.1 [Q5BJF6-7]
NP_702911.1, NM_153433.1 [Q5BJF6-1]
NP_702913.1, NM_153435.1
NP_702914.1, NM_153436.1 [Q5BJF6-10]
NP_702915.1, NM_153437.2 [Q5BJF6-5]
XP_006717189.1, XM_006717126.3 [Q5BJF6-1]
XP_016870261.1, XM_017014772.1
XP_016870262.1, XM_017014773.1
XP_016870263.1, XM_017014774.1
XP_016870264.1, XM_017014775.1 [Q5BJF6-3]
XP_016870265.1, XM_017014776.1 [Q5BJF6-3]
XP_016870266.1, XM_017014777.1
UniGeneiHs.129055

3D structure databases

ProteinModelPortaliQ5BJF6
SMRiQ5BJF6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111010, 131 interactors
IntActiQ5BJF6, 120 interactors
STRINGi9606.ENSP00000361882

Protein family/group databases

MoonProtiQ5BJF6

PTM databases

iPTMnetiQ5BJF6
PhosphoSitePlusiQ5BJF6

Polymorphism and mutation databases

BioMutaiODF2
DMDMi74736013

Proteomic databases

EPDiQ5BJF6
MaxQBiQ5BJF6
PaxDbiQ5BJF6
PeptideAtlasiQ5BJF6
PRIDEiQ5BJF6
ProteomicsDBi62680
62681 [Q5BJF6-2]
62682 [Q5BJF6-3]
62683 [Q5BJF6-4]
62684 [Q5BJF6-5]
62685 [Q5BJF6-6]
62686 [Q5BJF6-7]
62687 [Q5BJF6-8]
62688 [Q5BJF6-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4957
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351030; ENSP00000342581; ENSG00000136811 [Q5BJF6-4]
ENST00000372791; ENSP00000361877; ENSG00000136811 [Q5BJF6-5]
ENST00000372807; ENSP00000361893; ENSG00000136811 [Q5BJF6-4]
ENST00000372814; ENSP00000361901; ENSG00000136811 [Q5BJF6-7]
ENST00000393527; ENSP00000377161; ENSG00000136811 [Q5BJF6-3]
ENST00000393533; ENSP00000377166; ENSG00000136811 [Q5BJF6-10]
ENST00000434106; ENSP00000403453; ENSG00000136811 [Q5BJF6-1]
ENST00000444119; ENSP00000394506; ENSG00000136811 [Q5BJF6-3]
ENST00000448249; ENSP00000396687; ENSG00000136811 [Q5BJF6-9]
ENST00000546203; ENSP00000437579; ENSG00000136811 [Q5BJF6-8]
ENST00000604420; ENSP00000473949; ENSG00000136811 [Q5BJF6-1]
GeneIDi4957
KEGGihsa:4957
UCSCiuc004bva.4 human [Q5BJF6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4957
DisGeNETi4957
EuPathDBiHostDB:ENSG00000136811.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ODF2
HGNCiHGNC:8114 ODF2
HPAiHPA001874
HPA048841
MIMi602015 gene
neXtProtiNX_Q5BJF6
OpenTargetsiENSG00000136811
PharmGKBiPA31902

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IE8V Eukaryota
ENOG4111XWH LUCA
GeneTreeiENSGT00530000063497
HOGENOMiHOG000246967
HOVERGENiHBG052808
InParanoidiQ5BJF6
KOiK16479
OMAiNQAHIEV
OrthoDBiEOG091G13KV
PhylomeDBiQ5BJF6
TreeFamiTF328605

Enzyme and pathway databases

ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-8854518 AURKA Activation by TPX2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ODF2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ODF2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4957

Protein Ontology

More...
PROi
PR:Q5BJF6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000136811 Expressed in 182 organ(s), highest expression level in testis
CleanExiHS_ODF2
ExpressionAtlasiQ5BJF6 baseline and differential
GenevisibleiQ5BJF6 HS

Family and domain databases

InterProiView protein in InterPro
IPR026099 Odf2-rel
PANTHERiPTHR23162 PTHR23162, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiODFP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q5BJF6
Secondary accession number(s): B1AND3
, B4DRK4, B4DX73, B4DZ02, E7EWL2, F5H6J4, O14721, O60631, Q1W2J6, Q6UN26, Q7Z5I6, Q96FN2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: April 12, 2005
Last modified: November 7, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again