Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q59H18 (TNI3K_HUMAN)

Entry version 162 (11 Dec 2019)
Sequence version 3 (13 Jul 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein kinase TNNI3K

Gene

TNNI3K

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cardiac physiology.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei490ATP1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei588Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi469 – 477ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase TNNI3K (EC:2.7.11.1)
Alternative name(s):
Cardiac ankyrin repeat kinase
Cardiac troponin I-interacting kinase
TNNI3-interacting kinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNNI3KImported
Synonyms:CARK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000116783.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:19661 TNNI3K

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613932 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q59H18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cardiac conduction disease with or without dilated cardiomyopathy (CCDD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA cardiac disorder characterized by atrial tachyarrhythmia and conduction system disease. Some patients have dilated cardiomyopathy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_072650526G → D in CCDD; the mutation results in decreased protein solubility; causes abnormal aggregation; markedly reduced protein expression is observed in the sarcoplasm and nuclei of patient cardiomyocytes. 1 PublicationCorresponds to variant dbSNP:rs606231469EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi490K → R: Loss of autophosphorylation activity. 1 Publication1

Keywords - Diseasei

Cardiomyopathy, Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		100526835
51086

MalaCards human disease database

More...MalaCardsi		TNNI3K
MIMi616117 phenotype

Open Targets

More...OpenTargetsi		ENSG00000116783
ENSG00000259030

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		436242 Familial atrial tachyarrhythmia-infra-Hisian cardiac conduction disease

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134976654

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q59H18 Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5260

Drug and drug target database

More...DrugBanki		DB12010 Fostamatinib

DrugCentral

More...DrugCentrali		Q59H18

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNNI3K

Domain mapping of disease mutations (DMDM)

More...DMDMi		300669705

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000867571 – 835Serine/threonine-protein kinase TNNI3KAdd BLAST835

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q59H18

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q59H18

PeptideAtlas

More...PeptideAtlasi		Q59H18

PRoteomics IDEntifications database

More...PRIDEi		Q59H18

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		62665 [Q59H18-2]
62666 [Q59H18-1]
62667 [Q59H18-3]
62668 [Q59H18-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q59H18

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q59H18

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in both adult and fetal heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000116783 Expressed in 88 organ(s), highest expression level in heart

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q59H18 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q59H18 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA072331

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TNNI3, ACTC, ACTA1, MYBPC3, AIP, BABP3 and HADHB.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P194292EBI-704142,EBI-704146

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		119276, 11 interactors

Protein interaction database and analysis system

More...IntActi		Q59H18, 8 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000322251

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q59H18

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q59H18 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1835
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q59H18

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati66 – 96ANK 1Add BLAST31
Repeati100 – 129ANK 2Add BLAST30
Repeati133 – 162ANK 3Add BLAST30
Repeati166 – 195ANK 4Add BLAST30
Repeati199 – 228ANK 5Add BLAST30
Repeati234 – 263ANK 6Add BLAST30
Repeati269 – 298ANK 7Add BLAST30
Repeati304 – 335ANK 8Add BLAST32
Repeati339 – 368ANK 9Add BLAST30
Repeati381 – 410ANK 10Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini463 – 723Protein kinasePROSITE-ProRule annotationAdd BLAST261

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili21 – 51Sequence analysisAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi733 – 746Poly-SerAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.Curated

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IT5N Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159131

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000234421

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q59H18

KEGG Orthology (KO)

More...KOi		K17535

Database of Orthologous Groups

More...OrthoDBi		173077at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q59H18

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.20, 4 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12796 Ank_2, 3 hits
PF07714 Pkinase_Tyr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00248 ANK, 10 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48403 SSF48403, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 21 Publication (identifier: Q59H18-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNYKSRPTQ TCTDEWKKKV SESYVITIER LEDDLQIKEK ELTELRNIFG 
        60         70         80         90        100
SDEAFSKVNL NYRTENGLSL LHLCCICGGK KSHIRTLMLK GLRPSRLTRN 
       110        120        130        140        150
GFTALHLAVY KDNAELITSL LHSGADIQQV GYGGLTALHI ATIAGHLEAA 
       160        170        180        190        200
DVLLQHGANV NIQDAVFFTP LHIAAYYGHE QVTRLLLKFG ADVNVSGEVG 
       210        220        230        240        250
DRPLHLASAK GFLNIAKLLM EEGSKADVNA QDNEDHVPLH FCSRFGHHDI 
       260        270        280        290        300
VKYLLQSDLE VQPHVVNIYG DTPLHLACYN GKFEVAKEII QISGTESLTK 
       310        320        330        340        350
ENIFSETAFH SACTYGKSID LVKFLLDQNV ININHQGRDG HTGLHSACYH 
       360        370        380        390        400
GHIRLVQFLL DNGADMNLVA CDPSRSSGEK DEQTCLMWAY EKGHDAIVTL 
       410        420        430        440        450
LKHYKRPQDE LPCNEYSQPG GDGSYVSVPS PLGKIKSMTK EKADILLLRA 
       460        470        480        490        500
GLPSHFHLQL SEIEFHEIIG SGSFGKVYKG RCRNKIVAIK RYRANTYCSK 
       510        520        530        540        550
SDVDMFCREV SILCQLNHPC VIQFVGACLN DPSQFAIVTQ YISGGSLFSL 
       560        570        580        590        600
LHEQKRILDL QSKLIIAVDV AKGMEYLHNL TQPIIHRDLN SHNILLYEDG 
       610        620        630        640        650
HAVVADFGES RFLQSLDEDN MTKQPGNLRW MAPEVFTQCT RYTIKADVFS 
       660        670        680        690        700
YALCLWEILT GEIPFAHLKP AAAAADMAYH HIRPPIGYSI PKPISSLLIR 
       710        720        730        740        750
GWNACPEGRP EFSEVVMKLE ECLCNIELMS PASSNSSGSL SPSSSSDCLV 
       760        770        780        790        800
NRGGPGRSHV AALRSRFELE YALNARSYAA LSQSAGQYSS QGLSLEEMKR 
       810        820        830 
SLQYTPIDKY GYVSDPMSSM HFHSCRNSSS FEDSS
Length:835
Mass (Da):92,851
Last modified:July 13, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3B21484B434F46E8
GO
Isoform 1Curated (identifier: Q59H18-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.Curated
Show »
Length:936
Mass (Da):104,179
Checksum:i081220549646863F
GO
Isoform 3Curated (identifier: Q59H18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     591-596: SHNILL → RYFFPK
     597-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.Curated
Show »
Length:697
Mass (Da):77,957
Checksum:i7567E27D45485C9C
GO
Isoform 4Curated (identifier: Q59H18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     708-742: GRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSP → AKSRPSHYPVSSVYTETLKKKNEDRFGMWIEYLRR
     743-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.Curated
Show »
Length:843
Mass (Da):94,517
Checksum:i3001399FAEAD7B24
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCE9H0YCE9_HUMAN
Serine/threonine-protein kinase TNN...
TNNI3K
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDG1H0YDG1_HUMAN
Serine/threonine-protein kinase TNN...
TNNI3K
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YE48H0YE48_HUMAN
Serine/threonine-protein kinase TNN...
TNNI3K
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92178 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAE45949 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti127I → V in AAH32865 (PubMed:15489334).Curated1
Sequence conflicti250I → M in CAE45949 (PubMed:17974005).Curated1
Sequence conflicti367N → S in CAE45949 (PubMed:17974005).Curated1
Sequence conflicti629R → L in AAH32865 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_041223151D → H1 PublicationCorresponds to variant dbSNP:rs34874695Ensembl.1
Natural variantiVAR_041224263P → L1 PublicationCorresponds to variant dbSNP:rs34521608Ensembl.1
Natural variantiVAR_041225309F → L1 Publication1
Natural variantiVAR_041226430S → L in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041227510V → L1 PublicationCorresponds to variant dbSNP:rs34335537Ensembl.1
Natural variantiVAR_072650526G → D in CCDD; the mutation results in decreased protein solubility; causes abnormal aggregation; markedly reduced protein expression is observed in the sarcoplasm and nuclei of patient cardiomyocytes. 1 PublicationCorresponds to variant dbSNP:rs606231469EnsemblClinVar.1
Natural variantiVAR_035639629R → G in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_041228637T → M1 PublicationCorresponds to variant dbSNP:rs2274260Ensembl.1
Natural variantiVAR_041229686I → T1 PublicationCorresponds to variant dbSNP:rs3737564Ensembl.1
Natural variantiVAR_038821785A → G1 PublicationCorresponds to variant dbSNP:rs45578635Ensembl.1
Natural variantiVAR_041230798M → I in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs201613442Ensembl.1
Natural variantiVAR_038822833D → Y1 PublicationCorresponds to variant dbSNP:rs45614933Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0394031 – 13MGNYK…TQTCT → MAAARDPPEVSLREATQRKL RRFSELRGKLVARGEFWDIV AITAADEKQELAYNQQLSEK LKRKELPLGVQYHVFVDPAG AKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHS in isoform 1, isoform 3 and isoform 4. 3 PublicationsAdd BLAST13
Alternative sequenceiVSP_051882591 – 596SHNILL → RYFFPK in isoform 3. 1 Publication6
Alternative sequenceiVSP_051883597 – 835Missing in isoform 3. 1 PublicationAdd BLAST239
Alternative sequenceiVSP_051884708 – 742GRPEF…GSLSP → AKSRPSHYPVSSVYTETLKK KNEDRFGMWIEYLRR in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_051885743 – 835Missing in isoform 4. 1 PublicationAdd BLAST93

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF116826 mRNA Translation: AAD29632.1
AY303691 mRNA Translation: AAP72030.1
AB208941 Transcribed RNA Translation: BAD92178.1 Different initiation.
BX640903 mRNA Translation: CAE45949.1 Different initiation.
DQ822519 Genomic DNA Translation: ABG46944.1
AC093158 Genomic DNA No translation available.
AC098692 Genomic DNA No translation available.
AC105271 Genomic DNA No translation available.
AC119672 Genomic DNA No translation available.
BX470253 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06415.1
BC032865 mRNA Translation: AAH32865.1
BC113539 mRNA Translation: AAI13540.1
BC117262 mRNA Translation: AAI17263.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS664.1 [Q59H18-2]

NCBI Reference Sequences

More...RefSeqi		NP_001186256.2, NM_001199327.1
NP_057062.1, NM_015978.2 [Q59H18-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000326637; ENSP00000322251; ENSG00000116783 [Q59H18-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		100526835
51086

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:100526835
hsa:51086

UCSC genome browser

More...UCSCi		uc001dgf.3 human [Q59H18-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116826 mRNA Translation: AAD29632.1
AY303691 mRNA Translation: AAP72030.1
AB208941 Transcribed RNA Translation: BAD92178.1 Different initiation.
BX640903 mRNA Translation: CAE45949.1 Different initiation.
DQ822519 Genomic DNA Translation: ABG46944.1
AC093158 Genomic DNA No translation available.
AC098692 Genomic DNA No translation available.
AC105271 Genomic DNA No translation available.
AC119672 Genomic DNA No translation available.
BX470253 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06415.1
BC032865 mRNA Translation: AAH32865.1
BC113539 mRNA Translation: AAI13540.1
BC117262 mRNA Translation: AAI17263.1
CCDSiCCDS664.1 [Q59H18-2]
RefSeqiNP_001186256.2, NM_001199327.1
NP_057062.1, NM_015978.2 [Q59H18-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YFFX-ray3.07A/B/C/D420-730[»]
4YFIX-ray2.70A/B/C/D402-730[»]
6B5JX-ray2.97A/B/C/D420-730[»]
SMRiQ59H18
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi119276, 11 interactors
IntActiQ59H18, 8 interactors
STRINGi9606.ENSP00000322251

Chemistry databases

BindingDBiQ59H18
ChEMBLiCHEMBL5260
DrugBankiDB12010 Fostamatinib
DrugCentraliQ59H18

PTM databases

iPTMnetiQ59H18
PhosphoSitePlusiQ59H18

Polymorphism and mutation databases

BioMutaiTNNI3K
DMDMi300669705

Proteomic databases

MassIVEiQ59H18
PaxDbiQ59H18
PeptideAtlasiQ59H18
PRIDEiQ59H18
ProteomicsDBi62665 [Q59H18-2]
62666 [Q59H18-1]
62667 [Q59H18-3]
62668 [Q59H18-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		51086

Genome annotation databases

EnsembliENST00000326637; ENSP00000322251; ENSG00000116783 [Q59H18-2]
GeneIDi100526835
51086
KEGGihsa:100526835
hsa:51086
UCSCiuc001dgf.3 human [Q59H18-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		100526835
51086
DisGeNETi100526835
51086
EuPathDBiHostDB:ENSG00000116783.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNNI3K
HGNCiHGNC:19661 TNNI3K
HPAiHPA072331
MalaCardsiTNNI3K
MIMi613932 gene
616117 phenotype
neXtProtiNX_Q59H18
OpenTargetsiENSG00000116783
ENSG00000259030
Orphaneti436242 Familial atrial tachyarrhythmia-infra-Hisian cardiac conduction disease
PharmGKBiPA134976654

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IT5N Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000159131
HOGENOMiHOG000234421
InParanoidiQ59H18
KOiK17535
OrthoDBi173077at2759
PhylomeDBiQ59H18

Miscellaneous databases

PharosiQ59H18 Tchem

Protein Ontology

More...PROi		PR:Q59H18
RNActiQ59H18 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000116783 Expressed in 88 organ(s), highest expression level in heart
ExpressionAtlasiQ59H18 baseline and differential
GenevisibleiQ59H18 HS

Family and domain databases

Gene3Di1.25.40.20, 4 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
PfamiView protein in Pfam
PF12796 Ank_2, 3 hits
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 10 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNI3K_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q59H18
Secondary accession number(s): Q17RN0
, Q49AR1, Q6MZS9, Q9Y2V6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: July 13, 2010
Last modified: December 11, 2019
This is version 162 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again