Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DEP domain-containing mTOR-interacting protein

Gene

Deptor

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Negative regulator of the mTORC1 and mTORC2 signaling pathways. Inhibits the kinase activity of both complexes (By similarity).By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
DEP domain-containing mTOR-interacting protein
Alternative name(s):
DEP domain-containing protein 6
Gene namesi
Name:Deptor
Synonyms:Depdc6, Kiaa4200
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2146322 Deptor

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002847851 – 409DEP domain-containing mTOR-interacting proteinAdd BLAST409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei241PhosphothreonineBy similarity1
Modified residuei244PhosphoserineCombined sources1
Modified residuei258PhosphoserineBy similarity1
Modified residuei259PhosphothreonineBy similarity1
Modified residuei263PhosphoserineBy similarity1
Modified residuei265PhosphoserineCombined sources1
Modified residuei280PhosphoserineCombined sources1
Modified residuei282PhosphoserineBy similarity1
Modified residuei283PhosphoserineBy similarity1
Modified residuei287PhosphoserineBy similarity1
Modified residuei293PhosphoserineCombined sources1
Modified residuei297PhosphoserineBy similarity1
Modified residuei298PhosphoserineBy similarity1
Modified residuei299PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylation weakens interaction with MTOR within mTORC1 and mTORC2.By similarity
Ubiquitinated; ubiquitination leads to proteasomal degradation.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ570Y9
PRIDEiQ570Y9

PTM databases

iPTMnetiQ570Y9
PhosphoSitePlusiQ570Y9

Expressioni

Gene expression databases

BgeeiENSMUSG00000022419 Expressed in 254 organ(s), highest expression level in brown adipose tissue
CleanExiMM_DEPDC6
ExpressionAtlasiQ570Y9 baseline and differential
GenevisibleiQ570Y9 MM

Interactioni

Subunit structurei

Part of the mammalian target of rapamycin complex 1 (mTORC1) which contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR. Part of the mammalian target of rapamycin complex 2 (mTORC2) which contains MTOR, MLST8, PROTOR1, RICTOR, MAPKAP1 and DEPTOR. Interacts (via PDZ domain) with MTOR; interacts with MTOR within both mammalian target of rapamycin complexes mTORC1 and mTORC2 (By similarity). Interacts (via PDZ domain) with MINAR1 (via N-terminus) (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000094167

Structurei

3D structure databases

ProteinModelPortaliQ570Y9
SMRiQ570Y9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 119DEP 1PROSITE-ProRule annotationAdd BLAST84
Domaini146 – 219DEP 2PROSITE-ProRule annotationAdd BLAST74
Domaini330 – 407PDZPROSITE-ProRule annotationAdd BLAST78

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi235 – 299Ser-richAdd BLAST65

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IKSC Eukaryota
ENOG4110T1J LUCA
GeneTreeiENSGT00520000055667
HOVERGENiHBG056008
InParanoidiQ570Y9
KOiK20402
OMAiAHDSPFC
OrthoDBiEOG091G0AB3
PhylomeDBiQ570Y9

Family and domain databases

CDDicd04442 DEP_1_DEP6, 1 hit
cd04441 DEP_2_DEP6, 1 hit
Gene3Di1.10.10.10, 2 hits
InterProiView protein in InterPro
IPR000591 DEP_dom
IPR037589 DEPTOR
IPR037335 DEPTOR_DEP_1
IPR037336 DEPTOR_DEP_2
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR22829:SF18 PTHR22829:SF18, 1 hit
PfamiView protein in Pfam
PF00610 DEP, 2 hits
SMARTiView protein in SMART
SM00049 DEP, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF46785 SSF46785, 2 hits
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50186 DEP, 2 hits
PS50106 PDZ, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q570Y9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEGSSGGSG SSDSNAGGSG GVQQRELERM AEVLVTGEQL RLRLHEEKVI
60 70 80 90 100
KDRRHHLKTY PNCFVAKELI DWLIEHKEAS DRETAIKLMQ KLADRGIIHH
110 120 130 140 150
VCDEHKEFKD VKLFYRFRKD DGTFALDSEV KAFMRGQRLY EKLMSPETTL
160 170 180 190 200
LQPREEEGVK YERTFMASEF LDWLVQEGEA TTRKEAEQLC HRLMDHGIIQ
210 220 230 240 250
HVSNKHPFVD SNLLYQFRMN FRRRRRLMEL LNETSPSSQE THDSPFCLRK
260 270 280 290 300
QSHDSRKSTS FMSVSPSKEI KIVSAVRRSS MSSCGSSGYF SSSPTLSSSP
310 320 330 340 350
PVLCNPKSVL KRPVTSEELL TPGAPYARKT FTIVGDAVGW GFVVRGSKPC
360 370 380 390 400
HIQAVDPSGP AAAAGMKVCQ FVVSVNGLNV LNVDYRTVSN LILTGPRTIV

MEVMEELDC
Length:409
Mass (Da):46,120
Last modified:April 17, 2007 - v2
Checksum:i072062418DADDF8E
GO
Isoform 2 (identifier: Q570Y9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MEEGSSGGSGSSDSNAGGSGGVQQRELERMAEVLVTGEQL → MKQAFLVVLRHSISEDRLPPLSVITSGC

Note: No experimental confirmation available.
Show »
Length:397
Mass (Da):45,233
Checksum:i2F65AF24F475B601
GO
Isoform 3 (identifier: Q570Y9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-409: VCQFVVSVNG...VMEVMEELDC → DTGTESRKIVTSRLAWATWQDLMGGKVGGDAIPI

Note: No experimental confirmation available.
Show »
Length:401
Mass (Da):45,066
Checksum:iE502ECF5C3615B97
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B2ZRS5B2ZRS5_MOUSE
DEP domain-containing mTOR-interact...
Deptor Depdc6
401Annotation score:
A0A2I3BRE1A0A2I3BRE1_MOUSE
DEP domain-containing mTOR-interact...
Deptor
100Annotation score:

Sequence cautioni

The sequence BAD90225 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11S → G in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti125A → P in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti128S → N in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti149T → I in BAE26298 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0246481 – 40MEEGS…TGEQL → MKQAFLVVLRHSISEDRLPP LSVITSGC in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_024649368 – 409VCQFV…EELDC → DTGTESRKIVTSRLAWATWQ DLMGGKVGGDAIPI in isoform 3. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK220300 mRNA Translation: BAD90225.1 Different initiation.
AK139888 mRNA Translation: BAE24172.1
AK145208 mRNA Translation: BAE26298.1
CCDSiCCDS27474.1 [Q570Y9-1]
CCDS27475.1 [Q570Y9-2]
RefSeqiNP_001033026.1, NM_001037937.3 [Q570Y9-2]
NP_663445.2, NM_145470.3 [Q570Y9-1]
UniGeneiMm.295397
Mm.393497

Genome annotation databases

EnsembliENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419 [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419 [Q570Y9-1]
GeneIDi97998
KEGGimmu:97998
UCSCiuc007vsb.2 mouse [Q570Y9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK220300 mRNA Translation: BAD90225.1 Different initiation.
AK139888 mRNA Translation: BAE24172.1
AK145208 mRNA Translation: BAE26298.1
CCDSiCCDS27474.1 [Q570Y9-1]
CCDS27475.1 [Q570Y9-2]
RefSeqiNP_001033026.1, NM_001037937.3 [Q570Y9-2]
NP_663445.2, NM_145470.3 [Q570Y9-1]
UniGeneiMm.295397
Mm.393497

3D structure databases

ProteinModelPortaliQ570Y9
SMRiQ570Y9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000094167

PTM databases

iPTMnetiQ570Y9
PhosphoSitePlusiQ570Y9

Proteomic databases

PaxDbiQ570Y9
PRIDEiQ570Y9

Protocols and materials databases

DNASUi97998
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419 [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419 [Q570Y9-1]
GeneIDi97998
KEGGimmu:97998
UCSCiuc007vsb.2 mouse [Q570Y9-1]

Organism-specific databases

CTDi64798
MGIiMGI:2146322 Deptor
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IKSC Eukaryota
ENOG4110T1J LUCA
GeneTreeiENSGT00520000055667
HOVERGENiHBG056008
InParanoidiQ570Y9
KOiK20402
OMAiAHDSPFC
OrthoDBiEOG091G0AB3
PhylomeDBiQ570Y9

Miscellaneous databases

ChiTaRSiDeptor mouse
PROiPR:Q570Y9
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022419 Expressed in 254 organ(s), highest expression level in brown adipose tissue
CleanExiMM_DEPDC6
ExpressionAtlasiQ570Y9 baseline and differential
GenevisibleiQ570Y9 MM

Family and domain databases

CDDicd04442 DEP_1_DEP6, 1 hit
cd04441 DEP_2_DEP6, 1 hit
Gene3Di1.10.10.10, 2 hits
InterProiView protein in InterPro
IPR000591 DEP_dom
IPR037589 DEPTOR
IPR037335 DEPTOR_DEP_1
IPR037336 DEPTOR_DEP_2
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR22829:SF18 PTHR22829:SF18, 1 hit
PfamiView protein in Pfam
PF00610 DEP, 2 hits
SMARTiView protein in SMART
SM00049 DEP, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF46785 SSF46785, 2 hits
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50186 DEP, 2 hits
PS50106 PDZ, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDPTOR_MOUSE
AccessioniPrimary (citable) accession number: Q570Y9
Secondary accession number(s): Q3UM00, Q3UT08
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: November 7, 2018
This is version 101 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again