Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q570Y9 (DPTOR_MOUSE)

Entry version 112 (02 Dec 2020)
Sequence version 2 (17 Apr 2007)
Previous versions | rss
Add a publicationFeedback
Protein

DEP domain-containing mTOR-interacting protein

Gene

Deptor

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator of the mTORC1 and mTORC2 signaling pathways. Inhibits the kinase activity of both complexes (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DEP domain-containing mTOR-interacting protein
Alternative name(s):
DEP domain-containing protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Deptor
Synonyms:Depdc6, Kiaa4200
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2146322, Deptor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002847851 – 409DEP domain-containing mTOR-interacting proteinAdd BLAST409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei241PhosphothreonineBy similarity1
Modified residuei244PhosphoserineCombined sources1
Modified residuei258PhosphoserineBy similarity1
Modified residuei259PhosphothreonineBy similarity1
Modified residuei263PhosphoserineBy similarity1
Modified residuei265PhosphoserineCombined sources1
Modified residuei280PhosphoserineCombined sources1
Modified residuei282PhosphoserineBy similarity1
Modified residuei283PhosphoserineBy similarity1
Modified residuei287PhosphoserineBy similarity1
Modified residuei293PhosphoserineCombined sources1
Modified residuei297PhosphoserineBy similarity1
Modified residuei298PhosphoserineBy similarity1
Modified residuei299PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation weakens interaction with MTOR within mTORC1 and mTORC2.By similarity
Ubiquitinated; ubiquitination leads to proteasomal degradation.By similarity

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q570Y9

PRoteomics IDEntifications database

More...PRIDEi		Q570Y9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q570Y9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q570Y9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At postnatal day 1 (P1), in cartilage growth plate, primarily expressed in resting and proliferating chondrocytes. This expression pattern is maintained at least until P21 (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000022419, Expressed in brown adipose tissue and 271 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q570Y9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q570Y9, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the mammalian target of rapamycin complex 1 (mTORC1) which contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR. Part of the mammalian target of rapamycin complex 2 (mTORC2) which contains MTOR, MLST8, PROTOR1, RICTOR, MAPKAP1 and DEPTOR.

Interacts (via PDZ domain) with MTOR; interacts with MTOR within both mammalian target of rapamycin complexes mTORC1 and mTORC2 (By similarity).

Interacts (via PDZ domain) with MINAR1 (via N-terminus) (By similarity).

Interacts with SIK3 (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		220946, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000094167

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q570Y9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q570Y9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 119DEP 1PROSITE-ProRule annotationAdd BLAST84
Domaini146 – 219DEP 2PROSITE-ProRule annotationAdd BLAST74
Domaini330 – 407PDZPROSITE-ProRule annotationAdd BLAST78

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi235 – 299Ser-richAdd BLAST65

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QS4Y, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00520000055667

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_042535_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q570Y9

Identification of Orthologs from Complete Genome Data

More...OMAi		DTHDSPF

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q570Y9

Family and domain databases

Conserved Domains Database

More...CDDi		cd04442, DEP_1_DEP6, 1 hit
cd04441, DEP_2_DEP6, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.10, 2 hits
2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000591, DEP_dom
IPR037589, DEPTOR
IPR037335, DEPTOR_DEP_1
IPR037336, DEPTOR_DEP_2
IPR001478, PDZ
IPR036034, PDZ_sf
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf

The PANTHER Classification System

More...PANTHERi		PTHR22829:SF18, PTHR22829:SF18, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00610, DEP, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00049, DEP, 2 hits
SM00228, PDZ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46785, SSF46785, 2 hits
SSF50156, SSF50156, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50186, DEP, 2 hits
PS50106, PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q570Y9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEGSSGGSG SSDSNAGGSG GVQQRELERM AEVLVTGEQL RLRLHEEKVI 
        60         70         80         90        100
KDRRHHLKTY PNCFVAKELI DWLIEHKEAS DRETAIKLMQ KLADRGIIHH 
       110        120        130        140        150
VCDEHKEFKD VKLFYRFRKD DGTFALDSEV KAFMRGQRLY EKLMSPETTL 
       160        170        180        190        200
LQPREEEGVK YERTFMASEF LDWLVQEGEA TTRKEAEQLC HRLMDHGIIQ 
       210        220        230        240        250
HVSNKHPFVD SNLLYQFRMN FRRRRRLMEL LNETSPSSQE THDSPFCLRK 
       260        270        280        290        300
QSHDSRKSTS FMSVSPSKEI KIVSAVRRSS MSSCGSSGYF SSSPTLSSSP 
       310        320        330        340        350
PVLCNPKSVL KRPVTSEELL TPGAPYARKT FTIVGDAVGW GFVVRGSKPC 
       360        370        380        390        400
HIQAVDPSGP AAAAGMKVCQ FVVSVNGLNV LNVDYRTVSN LILTGPRTIV 

MEVMEELDC
Length:409
Mass (Da):46,120
Last modified:April 17, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i072062418DADDF8E
GO
Isoform 2 (identifier: Q570Y9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MEEGSSGGSGSSDSNAGGSGGVQQRELERMAEVLVTGEQL → MKQAFLVVLRHSISEDRLPPLSVITSGC

Show »
Length:397
Mass (Da):45,233
Checksum:i2F65AF24F475B601
GO
Isoform 3 (identifier: Q570Y9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-409: VCQFVVSVNG...VMEVMEELDC → DTGTESRKIVTSRLAWATWQDLMGGKVGGDAIPI

Show »
Length:401
Mass (Da):45,066
Checksum:iE502ECF5C3615B97
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B2ZRS5B2ZRS5_MOUSE
DEP domain-containing mTOR-interact...
Deptor Depdc6
401Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRE1A0A2I3BRE1_MOUSE
DEP domain-containing mTOR-interact...
Deptor
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD90225 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11S → G in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti125A → P in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti128S → N in BAE26298 (PubMed:16141072).Curated1
Sequence conflicti149T → I in BAE26298 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0246481 – 40MEEGS…TGEQL → MKQAFLVVLRHSISEDRLPP LSVITSGC in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_024649368 – 409VCQFV…EELDC → DTGTESRKIVTSRLAWATWQ DLMGGKVGGDAIPI in isoform 3. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK220300 mRNA Translation: BAD90225.1 Different initiation.
AK139888 mRNA Translation: BAE24172.1
AK145208 mRNA Translation: BAE26298.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS27474.1 [Q570Y9-1]
CCDS27475.1 [Q570Y9-2]

NCBI Reference Sequences

More...RefSeqi		NP_001033026.1, NM_001037937.3 [Q570Y9-2]
NP_663445.2, NM_145470.3 [Q570Y9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419 [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419 [Q570Y9-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		97998

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:97998

UCSC genome browser

More...UCSCi		uc007vsb.2, mouse [Q570Y9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK220300 mRNA Translation: BAD90225.1 Different initiation.
AK139888 mRNA Translation: BAE24172.1
AK145208 mRNA Translation: BAE26298.1
CCDSiCCDS27474.1 [Q570Y9-1]
CCDS27475.1 [Q570Y9-2]
RefSeqiNP_001033026.1, NM_001037937.3 [Q570Y9-2]
NP_663445.2, NM_145470.3 [Q570Y9-1]

3D structure databases

SMRiQ570Y9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi220946, 1 interactor
STRINGi10090.ENSMUSP00000094167

PTM databases

iPTMnetiQ570Y9
PhosphoSitePlusiQ570Y9

Proteomic databases

PaxDbiQ570Y9
PRIDEiQ570Y9

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		13704, 272 antibodies

The DNASU plasmid repository

More...DNASUi		97998

Genome annotation databases

EnsembliENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419 [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419 [Q570Y9-1]
GeneIDi97998
KEGGimmu:97998
UCSCiuc007vsb.2, mouse [Q570Y9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		64798
MGIiMGI:2146322, Deptor

Rodent Unidentified Gene-Encoded large proteins database

More...Rougei		Search...

Phylogenomic databases

eggNOGiENOG502QS4Y, Eukaryota
GeneTreeiENSGT00520000055667
HOGENOMiCLU_042535_0_0_1
InParanoidiQ570Y9
OMAiDTHDSPF
PhylomeDBiQ570Y9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		97998, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Deptor, mouse

Protein Ontology

More...PROi		PR:Q570Y9
RNActiQ570Y9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000022419, Expressed in brown adipose tissue and 271 other tissues
ExpressionAtlasiQ570Y9, baseline and differential
GenevisibleiQ570Y9, MM

Family and domain databases

CDDicd04442, DEP_1_DEP6, 1 hit
cd04441, DEP_2_DEP6, 1 hit
Gene3Di1.10.10.10, 2 hits
2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR000591, DEP_dom
IPR037589, DEPTOR
IPR037335, DEPTOR_DEP_1
IPR037336, DEPTOR_DEP_2
IPR001478, PDZ
IPR036034, PDZ_sf
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf
PANTHERiPTHR22829:SF18, PTHR22829:SF18, 1 hit
PfamiView protein in Pfam
PF00610, DEP, 2 hits
SMARTiView protein in SMART
SM00049, DEP, 2 hits
SM00228, PDZ, 1 hit
SUPFAMiSSF46785, SSF46785, 2 hits
SSF50156, SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50186, DEP, 2 hits
PS50106, PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDPTOR_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q570Y9
Secondary accession number(s): Q3UM00, Q3UT08
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: December 2, 2020
This is version 112 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again