Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 98 (11 Dec 2019)
Sequence version 1 (10 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 608

Gene

Znf608

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor, which represses ZNF609 transcription.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri552 – 577C2H2-typeAdd BLAST26

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 608
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Znf608
Synonyms:Kiaa1281, Zfp608
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2442338 Zfp608

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002804211 – 1511Zinc finger protein 608Add BLAST1511

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki282Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei420PhosphoserineCombined sources1
Modified residuei423PhosphoserineCombined sources1
Modified residuei480PhosphothreonineCombined sources1
Modified residuei492PhosphoserineCombined sources1
Modified residuei626PhosphoserineCombined sources1
Modified residuei781PhosphoserineCombined sources1
Cross-linki879Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei894PhosphoserineBy similarity1
Modified residuei963PhosphoserineBy similarity1
Modified residuei1097PhosphoserineBy similarity1
Cross-linki1117Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1181Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1198Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1233Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1249Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1291Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1309Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1413Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q56A10

PeptideAtlas

More...
PeptideAtlasi
Q56A10

PRoteomics IDEntifications database

More...
PRIDEi
Q56A10

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q56A10

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q56A10

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at low levels in thymocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052713 Expressed in 232 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q56A10 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q56A10 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000068192

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q56A10 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q56A10

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili277 – 303Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi140 – 263Gly-richAdd BLAST124
Compositional biasi309 – 314Poly-Pro6
Compositional biasi440 – 443Poly-Ala4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri552 – 577C2H2-typeAdd BLAST26

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIE1 Eukaryota
ENOG410Z79M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008748

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082539

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q56A10

Identification of Orthologs from Complete Genome Data

More...
OMAi
DRHSPFS

Database of Orthologous Groups

More...
OrthoDBi
60503at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q56A10

TreeFam database of animal gene trees

More...
TreeFami
TF329775

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040010 ZN608/ZN609
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR21564 PTHR21564, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q56A10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVNVSTAGK GVDPNTVDTY DSGDDWEIGV GNLIIDLDAD LEKDRQKFEM
60 70 80 90 100
NNSTNTTTNT TKDCGGPASN GTCSTSALAD GLKFASVQPS APQGNSHKET
110 120 130 140 150
SKSKVKRAKT SKDANKSLPS AALYGIPEIS STGKRQEVQG RPGEATGMNS
160 170 180 190 200
ALGQSVSGGG SSNPNSNGTS TGTSAATAGA GSCGKSKEEK PGKSHSSRGA
210 220 230 240 250
KRDKDAARSR KEKHDLLQGH QNGGGGQAPS GGHLYGFGTK SNGSGASPFH
260 270 280 290 300
CGGAGSGSVG AAGEVSKTAP DSTLMGNSML VKKEEEEEES HRRIKKLKTE
310 320 330 340 350
KVDPLFTVPA PPPPIASSLA PQIPPSYFPP SSSNIAAPVE QLLVRTRSVG
360 370 380 390 400
VNTCEVGVVT EPECLGPCEP GTSVNLEGIV WHETEEGVLV VNVTWRNKTY
410 420 430 440 450
VGTLLDCTKH DWAPPRFCES PTSDLEMRGG RGRGKRARSA AAAPGSEVSF
460 470 480 490 500
TESRGLQSKN RGGANGKGRR GSLNASGRRT PPNCAAEDIK ASPSSTNKRK
510 520 530 540 550
NKPPMELDLN SSSEDSKPGK RVRTNSRSTP TTPQGKPETT FLDQGCSSPV
560 570 580 590 600
LIDCPHPNCN KKYKHINGLR YHQAHAHLDP ENKLEFEPDS EDKISDCEEA
610 620 630 640 650
LSNVALECNE SSTSVSSYDQ TKAPGSPGAG NPPGTPKGKR EHVSNGPGPI
660 670 680 690 700
IGSKTGKNSG KKRGLNNELN NLPVISNMTA ALDICSATDS NLTAEMPKLE
710 720 730 740 750
AEGLIDKKSL GDKEKGKKAN NCKMDKNLSK LKSARPIAPA PAPTPPQLIA
760 770 780 790 800
IPTAAFTSTT TGTIPGLPSL TTTVVQATPK SPPLKPIQPK PTIMGEPITV
810 820 830 840 850
NPALVSLKDR KKKEKRKLKD KEGKETGGPK MDAKLGKLEE AKAASKDLSG
860 870 880 890 900
HFLKDHLGKS EGLANGLSES QESRMASIKA EADKVYTFTD NAPSPSIGSA
910 920 930 940 950
SRMECSTLVN GQAPMAPLHV LTQNGAESAA AKTSSPAYSD ISDAADDGGS
960 970 980 990 1000
DSRSEGMRSK ASSPSDTFSN KDGVVKGHPS TSAQPSQLKE SHSPYYHGYE
1010 1020 1030 1040 1050
PYYSPSYMHP GQVGAPAAGN GGSTQGMKIK KESEEDAEKK DKAEQLESKK
1060 1070 1080 1090 1100
VDHTSAPLQP QHQSVITQRH PALAQSLYYG QYAYGLYMDQ KSLMATSPAY
1110 1120 1130 1140 1150
RQQYEKYYED QRLAEQKMAQ SGRGDCERKA ELPLKELGKE DNKQKNMPSA
1160 1170 1180 1190 1200
TISKAPSTPE PNKNHSKLGP SVPNKTEETG KSQLLSSHQQ QLQADSFKAK
1210 1220 1230 1240 1250
QMENHQLIKE AVEMKSVMDS MKQTGVDPTS RFKQDPESRT WHHYVYQPKY
1260 1270 1280 1290 1300
LDQQKPEELD REKKLKEDSP RKTPNKESGV SSLPVSLTNI KEEPKEGKRP
1310 1320 1330 1340 1350
DSQSVEENKL KNDDRKTPVN WKDSRGTRVA VSSPMSQHQS YIQYLHAYPY
1360 1370 1380 1390 1400
PQMYDPSHPA YRAVSPVLMH SYPGAYLSPG FHYPVYGKMS GREEAEKVNT
1410 1420 1430 1440 1450
SPSINTKTAS EAKALDLLQH HANQYRSKSP APVEKASTER EREAERERDR
1460 1470 1480 1490 1500
HSPFSQRHLH THHHTHVGMG YPLIPGQYDP FQGLTSAALV ASQQVAAQAS
1510
ASGMFPAQRR E
Length:1,511
Mass (Da):162,345
Last modified:May 10, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4331F1298053D5AC
GO
Isoform 2 (identifier: Q56A10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1432-1455: PVEKASTEREREAERERDRHSPFS → VSLLLLVVKRPCLVGEGRQETEQS
     1456-1511: Missing.

Show »
Length:1,455
Mass (Da):156,027
Checksum:iF8CD6B9F2933AF91
GO
Isoform 3 (identifier: Q56A10-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-423: VLVVNVTWRNKTYVGTLLDCTKHDWAPPRFCESPTS → KYVLFLFISLCPLLHDVSLSICEGNLFSLWFERIER
     424-1511: Missing.

Show »
Length:423
Mass (Da):43,963
Checksum:i0A66BDA7F4AFE304
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A494B9K3A0A494B9K3_MOUSE
Zinc finger protein 608
Zfp608
303Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC36234 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti931 – 932AK → PN in BAC36234 (PubMed:16141072).Curated2
Sequence conflicti987Q → H in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1039K → N in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1436A → G in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1449D → G in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1490V → G in BAC36234 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_023665388 – 423VLVVN…ESPTS → KYVLFLFISLCPLLHDVSLS ICEGNLFSLWFERIER in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_023666424 – 1511Missing in isoform 3. 1 PublicationAdd BLAST1088
Alternative sequenceiVSP_0236671432 – 1455PVEKA…HSPFS → VSLLLLVVKRPCLVGEGRQE TEQS in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0236681456 – 1511Missing in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK047979 mRNA Translation: BAC33204.1
AK076178 mRNA Translation: BAC36234.1 Different initiation.
BC092219 mRNA Translation: AAH92219.1
AK129321 mRNA Translation: BAC98131.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37824.1 [Q56A10-1]

NCBI Reference Sequences

More...
RefSeqi
NP_786927.2, NM_175751.4 [Q56A10-1]
XP_006526020.1, XM_006525957.3 [Q56A10-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000064763; ENSMUSP00000068192; ENSMUSG00000052713 [Q56A10-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
269023

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:269023

UCSC genome browser

More...
UCSCi
uc008eyc.2 mouse [Q56A10-1]
uc008eyg.1 mouse [Q56A10-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK047979 mRNA Translation: BAC33204.1
AK076178 mRNA Translation: BAC36234.1 Different initiation.
BC092219 mRNA Translation: AAH92219.1
AK129321 mRNA Translation: BAC98131.1
CCDSiCCDS37824.1 [Q56A10-1]
RefSeqiNP_786927.2, NM_175751.4 [Q56A10-1]
XP_006526020.1, XM_006525957.3 [Q56A10-1]

3D structure databases

SMRiQ56A10
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068192

PTM databases

iPTMnetiQ56A10
PhosphoSitePlusiQ56A10

Proteomic databases

PaxDbiQ56A10
PeptideAtlasiQ56A10
PRIDEiQ56A10

Genome annotation databases

EnsembliENSMUST00000064763; ENSMUSP00000068192; ENSMUSG00000052713 [Q56A10-1]
GeneIDi269023
KEGGimmu:269023
UCSCiuc008eyc.2 mouse [Q56A10-1]
uc008eyg.1 mouse [Q56A10-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
269023
MGIiMGI:2442338 Zfp608

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IIE1 Eukaryota
ENOG410Z79M LUCA
GeneTreeiENSGT00390000008748
HOGENOMiHOG000082539
InParanoidiQ56A10
OMAiDRHSPFS
OrthoDBi60503at2759
PhylomeDBiQ56A10
TreeFamiTF329775

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zfp608 mouse

Protein Ontology

More...
PROi
PR:Q56A10
RNActiQ56A10 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052713 Expressed in 232 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ56A10 baseline and differential
GenevisibleiQ56A10 MM

Family and domain databases

InterProiView protein in InterPro
IPR040010 ZN608/ZN609
IPR013087 Znf_C2H2_type
PANTHERiPTHR21564 PTHR21564, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN608_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q56A10
Secondary accession number(s): Q6ZPU8, Q8BIG5, Q8BJ06
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: May 10, 2005
Last modified: December 11, 2019
This is version 98 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again