Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 96 (08 May 2019)
Sequence version 1 (10 May 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein Largen

Gene

PRR16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of cell size that promotes cell size increase independently of mTOR and Hippo signaling pathways. Acts by stimulating the translation of specific mRNAs, including those encoding proteins affecting mitochondrial functions. Increases mitochondrial mass and respiration.1 Publication

Miscellaneous

Was named 'Largen' because overexpression causes cells enlargement.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein Largen
Alternative name(s):
Mesenchymal stem cell protein DSC54
Proline-rich protein 16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRR16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29654 PRR16

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615931 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q569H4

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51334

Open Targets

More...
OpenTargetsi
ENSG00000184838

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162400155

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PRR16

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74735958

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003081591 – 304Protein LargenAdd BLAST304

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q569H4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q569H4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q569H4

PeptideAtlas

More...
PeptideAtlasi
Q569H4

PRoteomics IDEntifications database

More...
PRIDEi
Q569H4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62570
62571 [Q569H4-2]
62572 [Q569H4-3]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q569H4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184838 Expressed in 160 organ(s), highest expression level in descending thoracic aorta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q569H4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q569H4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049254

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119481, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q569H4, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000385118

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili33 – 70Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi102 – 291Pro-richAdd BLAST190

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGVQ Eukaryota
ENOG41129UN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00910000144204

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015766

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q569H4

Identification of Orthologs from Complete Genome Data

More...
OMAi
DVRYNIK

Database of Orthologous Groups

More...
OrthoDBi
1282387at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q569H4

TreeFam database of animal gene trees

More...
TreeFami
TF332746

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027997 Largen/INSYN1

The PANTHER Classification System

More...
PANTHERi
PTHR15917 PTHR15917, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15252 DUF4589, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q569H4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAKSKGNPS SSCPAEGPPA ASKTKVKEQI KIIVEDLELV LGDLKDVAKE
60 70 80 90 100
LKEVVDQIDT LTSDLQLEDE MTDSSKTDTL NSSSSGTTAS SLEKIKVQAN
110 120 130 140 150
APLIKPPAHP SAILTVLRKP NPPPPPPRLT PVKCEDPKRV VPTANPVKTN
160 170 180 190 200
GTLLRNGGLP GGPNKIPNGD ICCIPNSNLD KAPVQLLMHR PEKDRCPQAG
210 220 230 240 250
PRERVRFNEK VQYHGYCPDC DTRYNIKNRE VHLHSEPVHP PGKIPHQGPP
260 270 280 290 300
LPPTPHLPPF PLENGGMGIS HSNSFPPIRP ATVPPPTAPK PQKTILRKST

TTTV
Length:304
Mass (Da):32,812
Last modified:May 10, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i42FF6EFF0AE2D2BF
GO
Isoform 2 (identifier: Q569H4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:234
Mass (Da):25,306
Checksum:i753AD3C385F6E865
GO
Isoform 3 (identifier: Q569H4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MSAKSKGNPS...LKDVAKELKE → MAQSGLTATSASQVQAILLPQPASVRHYAW

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,387
Checksum:i3BA8E7A63DCB8F24
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RGF0D6RGF0_HUMAN
Protein Largen
PRR16
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSW7A0A0A0MSW7_HUMAN
Protein Largen
PRR16
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061694110P → T1 PublicationCorresponds to variant dbSNP:rs17853861Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0288801 – 70Missing in isoform 2. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0288811 – 53MSAKS…KELKE → MAQSGLTATSASQVQAILLP QPASVRHYAW in isoform 3. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF242769 mRNA Translation: AAF65446.1
CH471086 Genomic DNA Translation: EAW48904.1
CH471086 Genomic DNA Translation: EAW48906.1
BC038838 mRNA Translation: AAH38838.1
BC092474 mRNA Translation: AAH92474.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4127.1 [Q569H4-3]
CCDS75290.1 [Q569H4-1]
CCDS78053.1 [Q569H4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001287712.1, NM_001300783.1 [Q569H4-1]
NP_001295016.1, NM_001308087.1 [Q569H4-2]
NP_001295017.1, NM_001308088.1 [Q569H4-2]
NP_057728.1, NM_016644.2 [Q569H4-3]
XP_011541756.1, XM_011543454.2 [Q569H4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000379551; ENSP00000368869; ENSG00000184838 [Q569H4-3]
ENST00000407149; ENSP00000385118; ENSG00000184838 [Q569H4-1]
ENST00000505123; ENSP00000423446; ENSG00000184838 [Q569H4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51334

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51334

UCSC genome browser

More...
UCSCi
uc003ksp.4 human [Q569H4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF242769 mRNA Translation: AAF65446.1
CH471086 Genomic DNA Translation: EAW48904.1
CH471086 Genomic DNA Translation: EAW48906.1
BC038838 mRNA Translation: AAH38838.1
BC092474 mRNA Translation: AAH92474.1
CCDSiCCDS4127.1 [Q569H4-3]
CCDS75290.1 [Q569H4-1]
CCDS78053.1 [Q569H4-2]
RefSeqiNP_001287712.1, NM_001300783.1 [Q569H4-1]
NP_001295016.1, NM_001308087.1 [Q569H4-2]
NP_001295017.1, NM_001308088.1 [Q569H4-2]
NP_057728.1, NM_016644.2 [Q569H4-3]
XP_011541756.1, XM_011543454.2 [Q569H4-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi119481, 10 interactors
IntActiQ569H4, 4 interactors
STRINGi9606.ENSP00000385118

PTM databases

PhosphoSitePlusiQ569H4

Polymorphism and mutation databases

BioMutaiPRR16
DMDMi74735958

Proteomic databases

EPDiQ569H4
jPOSTiQ569H4
PaxDbiQ569H4
PeptideAtlasiQ569H4
PRIDEiQ569H4
ProteomicsDBi62570
62571 [Q569H4-2]
62572 [Q569H4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379551; ENSP00000368869; ENSG00000184838 [Q569H4-3]
ENST00000407149; ENSP00000385118; ENSG00000184838 [Q569H4-1]
ENST00000505123; ENSP00000423446; ENSG00000184838 [Q569H4-2]
GeneIDi51334
KEGGihsa:51334
UCSCiuc003ksp.4 human [Q569H4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51334
DisGeNETi51334

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PRR16
HGNCiHGNC:29654 PRR16
HPAiHPA049254
MIMi615931 gene
neXtProtiNX_Q569H4
OpenTargetsiENSG00000184838
PharmGKBiPA162400155

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGVQ Eukaryota
ENOG41129UN LUCA
GeneTreeiENSGT00910000144204
HOGENOMiHOG000015766
InParanoidiQ569H4
OMAiDVRYNIK
OrthoDBi1282387at2759
PhylomeDBiQ569H4
TreeFamiTF332746

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PRR16 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51334

Protein Ontology

More...
PROi
PR:Q569H4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184838 Expressed in 160 organ(s), highest expression level in descending thoracic aorta
ExpressionAtlasiQ569H4 baseline and differential
GenevisibleiQ569H4 HS

Family and domain databases

InterProiView protein in InterPro
IPR027997 Largen/INSYN1
PANTHERiPTHR15917 PTHR15917, 1 hit
PfamiView protein in Pfam
PF15252 DUF4589, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLARGN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q569H4
Secondary accession number(s): D3DSZ0, Q8IXY1, Q9NYI5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 10, 2005
Last modified: May 8, 2019
This is version 96 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again