Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynamin-like protein A

Gene

dlpA

Organism
Dictyostelium discoideum (Slime mold)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Involved in cytokinesis. May hydrolyze GTP.1 Publication

Catalytic activityi

GTP + H2O = GDP + phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi201 – 208GTPSequence analysis8
Nucleotide bindingi315 – 319GTPSequence analysis5
Nucleotide bindingi380 – 383GTPSequence analysis4

GO - Molecular functioni

GO - Biological processi

  • cell separation after cytokinesis Source: dictyBase
  • dynamin family protein polymerization involved in mitochondrial fission Source: GO_Central
  • membrane fusion Source: GO_Central
  • mitochondrial fission Source: GO_Central
  • mitotic cytokinesis Source: dictyBase
  • negative regulation of actin filament depolymerization Source: dictyBase
  • nucleus organization Source: dictyBase

Keywordsi

Molecular functionHydrolase, Motor protein
Biological processCell cycle, Cell division
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi3.6.5.5 1939

Names & Taxonomyi

Protein namesi
Recommended name:
Dynamin-like protein A (EC:3.6.5.5)
Gene namesi
Name:dlpA
Synonyms:slb233
ORF Names:DDB_G0268592
OrganismiDictyostelium discoideum (Slime mold)
Taxonomic identifieri44689 [NCBI]
Taxonomic lineageiEukaryotaAmoebozoaMycetozoaDictyostelidsDictyostelialesDictyosteliaceaeDictyostelium
Proteomesi
  • UP000002195 Componentsi: Chromosome 1, Unassembled WGS sequence

Organism-specific databases

dictyBaseiDDB_G0268592 dlpA

Subcellular locationi

GO - Cellular componenti

  • cleavage furrow Source: dictyBase
  • mitochondrial membrane Source: GO_Central

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Produced cells are larger and a large amount of them contains more than 2 nuclei.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003713371 – 880Dynamin-like protein AAdd BLAST880

Proteomic databases

PaxDbiQ55F94
PRIDEiQ55F94

Expressioni

Developmental stagei

Expression begins during cell cycle progression, between 12 and 24 hours after germination. Reach a maximum around mid-log phase and disappear during the stationary phase. Expressed in the central funnel of cells of migrating slugs and at the top of rising culminants. Not expressed until the slug stage.2 Publications

Inductioni

Induced by STATa.1 Publication

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi44689.DDB0233887

Structurei

3D structure databases

ProteinModelPortaliQ55F94
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini191 – 478Dynamin-type GPROSITE-ProRule annotationAdd BLAST288

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni201 – 208G1 motifPROSITE-ProRule annotation8
Regioni227 – 240G2 motifPROSITE-ProRule annotationAdd BLAST14
Regioni315 – 318G3 motifPROSITE-ProRule annotation4
Regioni380 – 383G4 motifPROSITE-ProRule annotation4
Regioni413 – 416G5 motifPROSITE-ProRule annotation4

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili69 – 152Sequence analysisAdd BLAST84
Coiled coili479 – 509Sequence analysisAdd BLAST31
Coiled coili824 – 861Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi13 – 16Poly-Lys4
Compositional biasi96 – 99Poly-Ala4
Compositional biasi132 – 138Poly-Ala7

Sequence similaritiesi

Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0446 Eukaryota
COG0699 LUCA
InParanoidiQ55F94
OMAiEEWGIPY
PhylomeDBiQ55F94

Family and domain databases

CDDicd08771 DLP_1, 1 hit
InterProiView protein in InterPro
IPR001401 Dynamin_GTPase
IPR022812 Dynamin_SF
IPR030381 G_DYNAMIN_dom
IPR027417 P-loop_NTPase
PANTHERiPTHR11566 PTHR11566, 1 hit
PfamiView protein in Pfam
PF00350 Dynamin_N, 1 hit
PRINTSiPR00195 DYNAMIN
SMARTiView protein in SMART
SM00053 DYNc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51718 G_DYNAMIN_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q55F94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVFKKKDKS DDKKKKHDEE TPQGTFQPAS QSTSNTNLNS LASSVNNGAS
60 70 80 90 100
VGSTNGSTPN NSNGSTPTYN HNNSAEELEK QKKEEDEKRK KSELEAAAAV
110 120 130 140 150
VAKKKEDEEK QRKEQVELER KRRDEEIRRT NAAAANAANK ELNEQVEISS
160 170 180 190 200
LEQMGKLDPS STIHDMFSFF PNEVYNSYEK LQYFSRDLNT AVSHPEIVFV
210 220 230 240 250
GPRSSGKSSL IEAFIGRALN IVGGGNIVGV GGSNANGCSK RVLYLQFTNN
260 270 280 290 300
IDFEVPKVTI KKDNTIKEFD HDIIVSIEQL NENLAKRNQL TNDYIEEPIY
310 320 330 340 350
VSIESRTTLN LTLIDSPGLL FDQSQAESNK IESIVSSLLR PSHRLIIAVE
360 370 380 390 400
SCSQDWKSMS MGQYLKKIDP ELSRSTFVFT KFHHTVRGFS STRDINKYLS
410 420 430 440 450
GTVPDIKGFF VTLPNHQVRA SYSEANRFQE KIYQAHKRDM HALEQLQYDK
460 470 480 490 500
RYERTIGVAP LRRYILNIVW KSYQDTIPRI LKHLRSKRQT AEATLNELQK
510 520 530 540 550
QSSSLDSTKL RSIASNYTVT FLQITEKLLS GTSEGNPSAN GQTLDEEKSQ
560 570 580 590 600
QGDCGEWVDA YKEAIYIDPE EWNIPYWSSK LYGGQQLERL MAEFKAVCDN
610 620 630 640 650
SKISEVKMDD IATASGINKL NNIPNYAWAA SDLTSLISRD TFVPLIEQLC
660 670 680 690 700
ERAMYIMKRL TDIADKVIDS RRKSRCIGSS PFGGNGLNNI NSGGNNGINI
710 720 730 740 750
NDRLSNTDMD SLDQYPFFTH HVKNLYYDFV HRAAKGCKEK CMDEFYSSRT
760 770 780 790 800
IYWELTEHPD SSLPSIRNDH HETKTAVCQL ATKLFDSIRQ RITKNVLLKL
810 820 830 840 850
YNFFLVPMQT DLWNEIQAQI TCLSNEQLEQ LFEVQATREQ LKQEEKKQQQ
860 870 880
ILEKYSQIDE QFLKAASLFC RPLSNPTPSA
Length:880
Mass (Da):100,009
Last modified:May 24, 2005 - v1
Checksum:i055ACA2D0D209512
GO
Isoform 2 (identifier: Q55F94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: E → EVDNKKI

Show »
Length:886
Mass (Da):100,707
Checksum:i95105711D627AFCA
GO
Isoform 3 (identifier: Q55F94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MSVFKKKDKSDDKKKKHDE → MISCTNHHRTIYQNNLNNSINNSNNTVDNKKI

Show »
Length:893
Mass (Da):101,404
Checksum:i1682C83CBFDA262A
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0370191 – 19MSVFK…KKHDE → MISCTNHHRTIYQNNLNNSI NNSNNTVDNKKI in isoform 3. CuratedAdd BLAST19
Alternative sequenceiVSP_03702019E → EVDNKKI in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AAFI02000003 Genomic DNA Translation: EAL73749.1
AAFI02000003 Genomic DNA Translation: EDR41124.1
AAFI02000003 Genomic DNA Translation: EEU04162.1
RefSeqiXP_001732949.1, XM_001732897.1
XP_002649212.1, XM_002649166.1
XP_647639.1, XM_642547.1

Genome annotation databases

EnsemblProtistsiEAL73749; EAL73749; DDB_G0268592
EDR41124; EDR41124; DDB_G0268592
EEU04162; EEU04162; DDB_G0268592
GeneIDi8616454
KEGGiddi:DDB_G0268592

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDLPA_DICDI
AccessioniPrimary (citable) accession number: Q55F94
Secondary accession number(s): B0G0Y6, C7FZW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: May 24, 2005
Last modified: May 23, 2018
This is version 76 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Dictyostelium discoideum
    Dictyostelium discoideum: entries, gene names and cross-references to dictyBase
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health