Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (16 Oct 2019)
Sequence version 1 (24 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytochrome b reductase 1

Gene

CYBRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ferric-chelate reductase that reduces Fe3+ to Fe2+. Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe3+ thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells.4 Publications

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

hemeBy similarityNote: Binds 2 heme groups non-covalently.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi50Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi86Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi108Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi120Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi159Iron (heme axial ligand)PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processElectron transport, Transport
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS01046-MONOMER

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-917937 Iron uptake and transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
5.B.2.1.3 the eukaryotic cytochrome b561 (cytb561) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome b reductase 1 (EC:1.-.-.-)
Alternative name(s):
Duodenal cytochrome b
Ferric-chelate reductase 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYBRD1
Synonyms:DCYTB, FRRS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20797 CYBRD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605745 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q53TN4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 32Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei49 – 69Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei85 – 105Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei123 – 143Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei158 – 178Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei199 – 219Helical; Name=6Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79901

Open Targets

More...
OpenTargetsi
ENSG00000071967

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134970061

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q53TN4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CYBRD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74726934

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003148301 – 286Cytochrome b reductase 1Add BLAST286

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi231N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei232PhosphoserineCombined sources1
Modified residuei285PhosphothreonineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q53TN4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q53TN4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q53TN4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q53TN4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q53TN4

PeptideAtlas

More...
PeptideAtlasi
Q53TN4

PRoteomics IDEntifications database

More...
PRIDEi
Q53TN4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5331
62547 [Q53TN4-1]
62548 [Q53TN4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q53TN4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q53TN4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q53TN4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By iron deficiency (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000071967 Expressed in 216 organ(s), highest expression level in layer of synovial tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q53TN4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q53TN4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014757
HPA056736

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
STX4Q128467EBI-8637742,EBI-744942

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122984, 39 interactors

Protein interaction database and analysis system

More...
IntActi
Q53TN4, 47 interactors

Molecular INTeraction database

More...
MINTi
Q53TN4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000319141

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1286
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q53TN4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 220Cytochrome b561PROSITE-ProRule annotationAdd BLAST206

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1619 Eukaryota
ENOG4111FKI LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183197

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231043

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q53TN4

KEGG Orthology (KO)

More...
KOi
K08370

Identification of Orthologs from Complete Genome Data

More...
OMAi
KAIFAIT

Database of Orthologous Groups

More...
OrthoDBi
1503869at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q53TN4

TreeFam database of animal gene trees

More...
TreeFami
TF314222

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028838 Cybrd1
IPR006593 Cyt_b561/ferric_Rdtase_TM

The PANTHER Classification System

More...
PANTHERi
PTHR10106:SF12 PTHR10106:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03188 Cytochrom_B561, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00665 B561, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50939 CYTOCHROME_B561, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q53TN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMEGYWRFL ALLGSALLVG FLSVIFALVW VLHYREGLGW DGSALEFNWH
60 70 80 90 100
PVLMVTGFVF IQGIAIIVYR LPWTWKCSKL LMKSIHAGLN AVAAILAIIS
110 120 130 140 150
VVAVFENHNV NNIANMYSLH SWVGLIAVIC YLLQLLSGFS VFLLPWAPLS
160 170 180 190 200
LRAFLMPIHV YSGIVIFGTV IATALMGLTE KLIFSLRDPA YSTFPPEGVF
210 220 230 240 250
VNTLGLLILV FGALIFWIVT RPQWKRPKEP NSTILHPNGG TEQGARGSMP
260 270 280
AYSGNNMDKS DSELNSEVAA RKRNLALDEA GQRSTM
Length:286
Mass (Da):31,641
Last modified:May 24, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i09AA921925A077F7
GO
Isoform 2 (identifier: Q53TN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     66-286: IIVYRLPWTW...LDEAGQRSTM → SFRFFSLSAS...DSHQTAMETS

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):17,903
Checksum:i581977048103DD99
GO
Isoform 3 (identifier: Q53TN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGI → MLDEGE

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,087
Checksum:iC97981AD12C20361
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JML1C9JML1_HUMAN
Cytochrome b reductase 1
CYBRD1
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAG29366 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAG29367 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7W → R in CAB66628 (PubMed:11230166).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in CYBRD1 may act as modifier of iron overload expression and account for the variance observed in serum ferritin levels in patients with hereditary hemochromatosis.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038065156M → T1 PublicationCorresponds to variant dbSNP:rs16859487Ensembl.1
Natural variantiVAR_038066226R → H in some patients with hereditary hemochromatosis. 2 PublicationsCorresponds to variant dbSNP:rs62181680Ensembl.1
Natural variantiVAR_038067266S → N4 PublicationsCorresponds to variant dbSNP:rs10455Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0449451 – 64MAMEG…FIQGI → MLDEGE in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_04203966 – 286IIVYR…QRSTM → SFRFFSLSASMGSAFSPSIS HAHTCLFWNCHLWNSDCNST YGIDRETDFFPERSCIQYIP ARRCFRKYAWPSDPGVRGPH FLDSHQTAMETS in isoform 2. 1 PublicationAdd BLAST221

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136693 mRNA Translation: CAB66628.1
AK027115 mRNA Translation: BAB15661.1
AK128495 mRNA Translation: BAC87466.1
AK291731 mRNA Translation: BAF84420.1
AK301485 mRNA Translation: BAG62999.1
AK316588 mRNA Translation: BAG38176.1
DQ496101 Genomic DNA Translation: ABF47090.1
AC007969 Genomic DNA Translation: AAY14730.1
CH471058 Genomic DNA Translation: EAX11210.1
BC065290 mRNA Translation: AAH65290.1
AJ715523 Genomic DNA Translation: CAG29366.1 Sequence problems.
AJ715524 Genomic DNA Translation: CAG29367.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2244.1 [Q53TN4-1]
CCDS46449.1 [Q53TN4-2]
CCDS58736.1 [Q53TN4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001120855.1, NM_001127383.1 [Q53TN4-2]
NP_001243838.1, NM_001256909.1 [Q53TN4-3]
NP_079119.3, NM_024843.3 [Q53TN4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000321348; ENSP00000319141; ENSG00000071967 [Q53TN4-1]
ENST00000375252; ENSP00000364401; ENSG00000071967 [Q53TN4-2]
ENST00000409484; ENSP00000386739; ENSG00000071967 [Q53TN4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79901

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79901

UCSC genome browser

More...
UCSCi
uc002ugy.5 human [Q53TN4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136693 mRNA Translation: CAB66628.1
AK027115 mRNA Translation: BAB15661.1
AK128495 mRNA Translation: BAC87466.1
AK291731 mRNA Translation: BAF84420.1
AK301485 mRNA Translation: BAG62999.1
AK316588 mRNA Translation: BAG38176.1
DQ496101 Genomic DNA Translation: ABF47090.1
AC007969 Genomic DNA Translation: AAY14730.1
CH471058 Genomic DNA Translation: EAX11210.1
BC065290 mRNA Translation: AAH65290.1
AJ715523 Genomic DNA Translation: CAG29366.1 Sequence problems.
AJ715524 Genomic DNA Translation: CAG29367.1 Sequence problems.
CCDSiCCDS2244.1 [Q53TN4-1]
CCDS46449.1 [Q53TN4-2]
CCDS58736.1 [Q53TN4-3]
RefSeqiNP_001120855.1, NM_001127383.1 [Q53TN4-2]
NP_001243838.1, NM_001256909.1 [Q53TN4-3]
NP_079119.3, NM_024843.3 [Q53TN4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5ZLEX-ray2.60A1-286[»]
5ZLGX-ray2.80A1-286[»]
SMRiQ53TN4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi122984, 39 interactors
IntActiQ53TN4, 47 interactors
MINTiQ53TN4
STRINGi9606.ENSP00000319141

Protein family/group databases

TCDBi5.B.2.1.3 the eukaryotic cytochrome b561 (cytb561) family

PTM databases

iPTMnetiQ53TN4
PhosphoSitePlusiQ53TN4
SwissPalmiQ53TN4

Polymorphism and mutation databases

BioMutaiCYBRD1
DMDMi74726934

Proteomic databases

EPDiQ53TN4
jPOSTiQ53TN4
MassIVEiQ53TN4
MaxQBiQ53TN4
PaxDbiQ53TN4
PeptideAtlasiQ53TN4
PRIDEiQ53TN4
ProteomicsDBi5331
62547 [Q53TN4-1]
62548 [Q53TN4-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79901

Genome annotation databases

EnsembliENST00000321348; ENSP00000319141; ENSG00000071967 [Q53TN4-1]
ENST00000375252; ENSP00000364401; ENSG00000071967 [Q53TN4-2]
ENST00000409484; ENSP00000386739; ENSG00000071967 [Q53TN4-3]
GeneIDi79901
KEGGihsa:79901
UCSCiuc002ugy.5 human [Q53TN4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79901
DisGeNETi79901

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CYBRD1
HGNCiHGNC:20797 CYBRD1
HPAiHPA014757
HPA056736
MIMi605745 gene
neXtProtiNX_Q53TN4
OpenTargetsiENSG00000071967
PharmGKBiPA134970061

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1619 Eukaryota
ENOG4111FKI LUCA
GeneTreeiENSGT00950000183197
HOGENOMiHOG000231043
InParanoidiQ53TN4
KOiK08370
OMAiKAIFAIT
OrthoDBi1503869at2759
PhylomeDBiQ53TN4
TreeFamiTF314222

Enzyme and pathway databases

BioCyciMetaCyc:HS01046-MONOMER
ReactomeiR-HSA-917937 Iron uptake and transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CYBRD1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79901
PharosiQ53TN4

Protein Ontology

More...
PROi
PR:Q53TN4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000071967 Expressed in 216 organ(s), highest expression level in layer of synovial tissue
ExpressionAtlasiQ53TN4 baseline and differential
GenevisibleiQ53TN4 HS

Family and domain databases

InterProiView protein in InterPro
IPR028838 Cybrd1
IPR006593 Cyt_b561/ferric_Rdtase_TM
PANTHERiPTHR10106:SF12 PTHR10106:SF12, 1 hit
PfamiView protein in Pfam
PF03188 Cytochrom_B561, 1 hit
SMARTiView protein in SMART
SM00665 B561, 1 hit
PROSITEiView protein in PROSITE
PS50939 CYTOCHROME_B561, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCYBR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53TN4
Secondary accession number(s): B2RE79
, B4DWD7, Q6KC16, Q6KC17, Q6P147, Q6ZR51, Q9H0Q8, Q9H5G5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 24, 2005
Last modified: October 16, 2019
This is version 130 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again