Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cordon-bleu protein-like 1

Gene

COBLL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cordon-bleu protein-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COBLL1
Synonyms:KIAA0977
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000082438.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23571 COBLL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610318 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q53SF7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22837

Open Targets

More...
OpenTargetsi
ENSG00000082438

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134990267

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COBLL1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002604931 – 1204Cordon-bleu protein-like 1Add BLAST1204

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei177PhosphothreonineBy similarity1
Modified residuei242PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei298PhosphothreonineCombined sources1
Modified residuei311PhosphoserineCombined sources1
Modified residuei322PhosphothreonineCombined sources1
Modified residuei364PhosphoserineBy similarity1
Modified residuei371PhosphoserineBy similarity1
Modified residuei382PhosphoserineCombined sources1
Modified residuei394PhosphoserineCombined sources1
Modified residuei515PhosphoserineCombined sources1
Modified residuei518PhosphoserineCombined sources1
Modified residuei538PhosphoserineBy similarity1
Modified residuei548PhosphoserineBy similarity1
Modified residuei551PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei660PhosphoserineBy similarity1
Modified residuei862PhosphoserineCombined sources1
Modified residuei889PhosphoserineBy similarity1
Modified residuei890PhosphoserineCombined sources1
Modified residuei897PhosphoserineCombined sources1
Modified residuei987PhosphoserineCombined sources1
Modified residuei993PhosphoserineCombined sources1
Modified residuei1023PhosphoserineBy similarity1
Modified residuei1145PhosphoserineBy similarity1
Modified residuei1146PhosphoserineBy similarity1
Modified residuei1197PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q53SF7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q53SF7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q53SF7

PeptideAtlas

More...
PeptideAtlasi
Q53SF7

PRoteomics IDEntifications database

More...
PRIDEi
Q53SF7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62536
62537 [Q53SF7-2]
62538 [Q53SF7-3]
62539 [Q53SF7-4]
62540 [Q53SF7-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q53SF7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q53SF7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000082438 Expressed in 216 organ(s), highest expression level in chorionic villus

CleanEx database of gene expression profiles

More...
CleanExi
HS_COBLL1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q53SF7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q53SF7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044933
HPA053344

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116511, 29 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q53SF7

Protein interaction database and analysis system

More...
IntActi
Q53SF7, 22 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341360

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11204
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DAJNMR-A182-259[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q53SF7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q53SF7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q53SF7

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1157 – 1177WH2PROSITE-ProRule annotationAdd BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi329 – 334KKRRAP 16
Motifi398 – 403KKRRAP 26

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIGI Eukaryota
ENOG4111I5R LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063608

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105908

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q53SF7

Database of Orthologous Groups

More...
OrthoDBi
986623at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q53SF7

TreeFam database of animal gene trees

More...
TreeFami
TF333490

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039895 COBL-like
IPR019025 Cordon-bleu_ubiquitin_domain
IPR003124 WH2_dom

The PANTHER Classification System

More...
PANTHERi
PTHR21557 PTHR21557, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09469 Cobl, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51082 WH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q53SF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCGRAAEAAA SSRTPGREMG QAVTRRLGAG ARAAPRRAMD GRTPRPQDAP
60 70 80 90 100
ARRKPKAKAP LPPAETKYTD VSSAADSVES TAFIMEQKEN MIDKDVELSV
110 120 130 140 150
VLPGDIIKST TVHGSKPMMD LLIFLCAQYH LNPSSYTIDL LSAEQNHIKF
160 170 180 190 200
KPNTPIGMLE VEKVILKPKM LDKKKPTPII PEKTVRVVIN FKKTQKTIVR
210 220 230 240 250
VSPHASLQEL APIICSKCEF DPLHTLLLKD YQSQEPLDLT KSLNDLGLRE
260 270 280 290 300
LYAMDVNRES CQISQNLDIM KEKENKGFFS FFQRSKKKRD QTASAPATPL
310 320 330 340 350
VNKHRPTFTR SNTISKPYIS NTLPSDAPKK RRAPLPPMPA SQSVPQDLAH
360 370 380 390 400
IQERPASCIV KSMSVDETDK SPCEAGRVRA GSLQLSSMSA GNSSLRRTKR
410 420 430 440 450
KAPSPPSKIP PHQSDENSRV TALQPVDGVP PDSASEANSP EELSSPETFH
460 470 480 490 500
PGLSSQEQCT APKLMEETSV FECPGTPEAA ITSLTSGISS DYSLEEIDEK
510 520 530 540 550
EELSEVPKVE AENISPKSQD IPFVSTDIIN TLKNDPDSAL GNGSGEFSQN
560 570 580 590 600
SMEEKQETKS TDGQEPHSVV YDTSNGKKVV DSIRNLKSLG PNQENVQNEI
610 620 630 640 650
IVYPENTEDN MKNGVKKTEI NVEGVAKNNN IDMEVERPSN SEAHETDTAI
660 670 680 690 700
SYKENHLAAS SVPDQKLNQP SAEKTKDAAI QTTPSCNSFD GKHQDHNLSD
710 720 730 740 750
SKVEECVQTS NNNISTQHSC LSSQDSVNTS REFRSQGTLI IHSEDPLTVK
760 770 780 790 800
DPICAHGNDD LLPPVDRIDK NSTASYLKNY PLYRQDYNPK PKPSNEITRE
810 820 830 840 850
YIPKIGMTTY KIVPPKSLEI SKDWQSETIE YKDDQDMHAL GKKHTHENVK
860 870 880 890 900
ETAIQTEDSA ISESPEEPLP NLKPKPNLRT EHQVPSSVSS PDDAMVSPLK
910 920 930 940 950
PAPKMTRDTG TAPFAPNLEE INNILESKFK SRASNAQAKP SSFFLQMQKR
960 970 980 990 1000
VSGHYVTSAA AKSVHAAPNP APKELTNKEA ERDMLPSPEQ TLSPLSKMPH
1010 1020 1030 1040 1050
SVPQPLVEKT DDDVIGQAPA EASPPPIAPK PVTIPASQVS TQNLKTLKTF
1060 1070 1080 1090 1100
GAPRPYSSSG PSPFALAVVK RSQSFSKERT ESPSASALVQ PPANTEEGKT
1110 1120 1130 1140 1150
HSVNKFVDIP QLGVSDKENN SAHNEQNSQI PTPTDGPSFT VMRQSSLTFQ
1160 1170 1180 1190 1200
SSDPEQMRQS LLTAIRSGEA AAKLKRVTIP SNTISVNGRS RLSHSMSPDA

QDGH
Length:1,204
Mass (Da):131,787
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6BA6F2ADF3440670
GO
Isoform 2 (identifier: Q53SF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     447-486: ETFHPGLSSQEQCTAPKLMEETSVFECPGTPEAAITSLTS → A
     595-595: N → NV

Show »
Length:1,166
Mass (Da):127,719
Checksum:i0FBC2D76FA27E9B6
GO
Isoform 3 (identifier: Q53SF7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.

Show »
Length:1,166
Mass (Da):127,935
Checksum:i25D9282A915026E6
GO
Isoform 4 (identifier: Q53SF7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     447-486: ETFHPGLSSQEQCTAPKLMEETSVFECPGTPEAAITSLTS → A
     595-595: N → NV

Show »
Length:1,128
Mass (Da):123,868
Checksum:iB0BC3812F4BA93E8
GO
Isoform 5 (identifier: Q53SF7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     115-144: SKPMMDLLIFLCAQYHLNPSSYTIDLLSAE → RYAGVNEISGPPLLIPPLKVSVIYVLMFVL
     145-1204: Missing.

Show »
Length:106
Mass (Da):11,516
Checksum:i5922939ACD3632B9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0D9SG04A0A0D9SG04_HUMAN
Cordon-bleu protein-like 1
COBLL1
1,233Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JAU3C9JAU3_HUMAN
Cordon-bleu protein-like 1
COBLL1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5Y6C9J5Y6_HUMAN
Cordon-bleu protein-like 1
COBLL1
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1G2H7C1G2_HUMAN
Cordon-bleu protein-like 1
COBLL1
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J1Z0A0A0B4J1Z0_HUMAN
COBL-like 1, isoform CRA_a
COBLL1 hCG_39012
424Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JK90C9JK90_HUMAN
Cordon-bleu protein-like 1
COBLL1
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWZ0C9JWZ0_HUMAN
Cordon-bleu protein-like 1
COBLL1
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8C4C9J8C4_HUMAN
Cordon-bleu protein-like 1
COBLL1
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEK0F8WEK0_HUMAN
Cordon-bleu protein-like 1
COBLL1
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0X1KG75A0A0X1KG75_HUMAN
Cordon-bleu protein-like 1
COBLL1
1,168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA76821 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB43215 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti368T → A in AAH71588 (PubMed:15489334).Curated1
Sequence conflicti845T → G in CAB43215 (PubMed:17974005).Curated1
Sequence conflicti947M → T in CAD97877 (PubMed:17974005).Curated1
Sequence conflicti1048K → E in AAH71588 (PubMed:15489334).Curated1
Sequence conflicti1095T → A in CAD97877 (PubMed:17974005).Curated1
Sequence conflicti1151S → G in CAB43215 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0216211 – 38Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST38
Alternative sequenceiVSP_021622115 – 144SKPMM…LLSAE → RYAGVNEISGPPLLIPPLKV SVIYVLMFVL in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_021623145 – 1204Missing in isoform 5. 1 PublicationAdd BLAST1060
Alternative sequenceiVSP_021624447 – 486ETFHP…TSLTS → A in isoform 2 and isoform 4. 3 PublicationsAdd BLAST40
Alternative sequenceiVSP_021625595N → NV in isoform 2 and isoform 4. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB023194 mRNA Translation: BAA76821.2 Different initiation.
AK225849 mRNA No translation available.
AC019181 Genomic DNA Translation: AAX93068.1
CH471058 Genomic DNA Translation: EAX11340.1
BC006264 mRNA Translation: AAH06264.1
BC071588 mRNA Translation: AAH71588.1
AL049939 mRNA Translation: CAB43215.1 Different initiation.
BX537877 mRNA Translation: CAD97877.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2223.2 [Q53SF7-3]
CCDS63045.1 [Q53SF7-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08673

NCBI Reference Sequences

More...
RefSeqi
NP_001265387.1, NM_001278458.1
NP_001265389.1, NM_001278460.1
NP_001265390.1, NM_001278461.1 [Q53SF7-4]
NP_055715.3, NM_014900.4 [Q53SF7-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.470457
Hs.744314

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000342193; ENSP00000341360; ENSG00000082438 [Q53SF7-3]
ENST00000375458; ENSP00000364607; ENSG00000082438 [Q53SF7-4]
ENST00000392717; ENSP00000376478; ENSG00000082438 [Q53SF7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22837

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22837

UCSC genome browser

More...
UCSCi
uc002ucp.5 human [Q53SF7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023194 mRNA Translation: BAA76821.2 Different initiation.
AK225849 mRNA No translation available.
AC019181 Genomic DNA Translation: AAX93068.1
CH471058 Genomic DNA Translation: EAX11340.1
BC006264 mRNA Translation: AAH06264.1
BC071588 mRNA Translation: AAH71588.1
AL049939 mRNA Translation: CAB43215.1 Different initiation.
BX537877 mRNA Translation: CAD97877.2
CCDSiCCDS2223.2 [Q53SF7-3]
CCDS63045.1 [Q53SF7-4]
PIRiT08673
RefSeqiNP_001265387.1, NM_001278458.1
NP_001265389.1, NM_001278460.1
NP_001265390.1, NM_001278461.1 [Q53SF7-4]
NP_055715.3, NM_014900.4 [Q53SF7-3]
UniGeneiHs.470457
Hs.744314

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DAJNMR-A182-259[»]
ProteinModelPortaliQ53SF7
SMRiQ53SF7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116511, 29 interactors
CORUMiQ53SF7
IntActiQ53SF7, 22 interactors
STRINGi9606.ENSP00000341360

PTM databases

iPTMnetiQ53SF7
PhosphoSitePlusiQ53SF7

Polymorphism and mutation databases

BioMutaiCOBLL1

Proteomic databases

jPOSTiQ53SF7
MaxQBiQ53SF7
PaxDbiQ53SF7
PeptideAtlasiQ53SF7
PRIDEiQ53SF7
ProteomicsDBi62536
62537 [Q53SF7-2]
62538 [Q53SF7-3]
62539 [Q53SF7-4]
62540 [Q53SF7-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342193; ENSP00000341360; ENSG00000082438 [Q53SF7-3]
ENST00000375458; ENSP00000364607; ENSG00000082438 [Q53SF7-4]
ENST00000392717; ENSP00000376478; ENSG00000082438 [Q53SF7-1]
GeneIDi22837
KEGGihsa:22837
UCSCiuc002ucp.5 human [Q53SF7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22837
DisGeNETi22837
EuPathDBiHostDB:ENSG00000082438.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COBLL1
HGNCiHGNC:23571 COBLL1
HPAiHPA044933
HPA053344
MIMi610318 gene
neXtProtiNX_Q53SF7
OpenTargetsiENSG00000082438
PharmGKBiPA134990267

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIGI Eukaryota
ENOG4111I5R LUCA
GeneTreeiENSGT00530000063608
HOVERGENiHBG105908
InParanoidiQ53SF7
OrthoDBi986623at2759
PhylomeDBiQ53SF7
TreeFamiTF333490

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COBLL1 human
EvolutionaryTraceiQ53SF7

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
COBLL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22837

Protein Ontology

More...
PROi
PR:Q53SF7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000082438 Expressed in 216 organ(s), highest expression level in chorionic villus
CleanExiHS_COBLL1
ExpressionAtlasiQ53SF7 baseline and differential
GenevisibleiQ53SF7 HS

Family and domain databases

InterProiView protein in InterPro
IPR039895 COBL-like
IPR019025 Cordon-bleu_ubiquitin_domain
IPR003124 WH2_dom
PANTHERiPTHR21557 PTHR21557, 1 hit
PfamiView protein in Pfam
PF09469 Cobl, 1 hit
PROSITEiView protein in PROSITE
PS51082 WH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOBL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53SF7
Secondary accession number(s): A6NMZ3
, Q6IQ33, Q7Z3I6, Q9BRH4, Q9UG88, Q9Y2I3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: January 16, 2019
This is version 114 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again