Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 98 (18 Sep 2019)
Sequence version 1 (24 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Folate transporter-like protein C2orf83

Gene

C2orf83

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Although related to reduced folate carrier family, it lacks transmembrane domains, suggesting that it has probably no transporter function.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Folate transporter-like protein C2orf83
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:C2orf83
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25344 C2orf83

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q53S99

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56918

Open Targets

More...
OpenTargetsi
ENSG00000042304

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164717149

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C2orf83

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003205501 – 150Folate transporter-like protein C2orf83Add BLAST150

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q53S99

PRoteomics IDEntifications database

More...
PRIDEi
Q53S99

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62534 [Q53S99-1]
7384

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q53S99

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000042304 Expressed in 24 organ(s), highest expression level in buccal mucosa cell

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q53S99 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030319

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q53S99, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000264387

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3810 Eukaryota
ENOG410XT34 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183022

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111339

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q53S99

Identification of Orthologs from Complete Genome Data

More...
OMAi
GHGLCHP

Database of Orthologous Groups

More...
OrthoDBi
1405747at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q53S99

TreeFam database of animal gene trees

More...
TreeFami
TF341245

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002666 Folate_carrier

The PANTHER Classification System

More...
PANTHERi
PTHR10686 PTHR10686, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01770 Folate_carrier, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q53S99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDYALTFGI NPFIALMIQP IVTMTVVDNQ GLGLPVDIQH KAKPSPKASQ
60 70 80 90 100
MLPPDLGPPS FQNLLSPSEK LEPWDPGMRK LTVQTCGLTF IHPAGHGLCH
110 120 130 140 150
PTAEASAETL SSTALNRPSV REGACNEKST ENKKPQDSVL WSHSRWFQGN
Length:150
Mass (Da):16,373
Last modified:May 24, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i240FC8BFB6EB5B44
GO
Isoform 2 (identifier: Q53S99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-150: LLSPSEKLEP...WSHSRWFQGN → CFTCRTAPSLVMVLSWKSGVRREVPVHPSYAKY

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):10,585
Checksum:i6D1771D64D60FFBE
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB95774 differs from that shown. Reason: Erroneous termination at position 141. Translated as Trp.Curated
The sequence CAH18470 differs from that shown. Reason: Erroneous termination at position 141. Translated as Trp.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11N → D in AK055355 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06186545S → L. Corresponds to variant dbSNP:rs28739019Ensembl.1
Natural variantiVAR_039201104E → Q2 PublicationsCorresponds to variant dbSNP:rs2138402Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04540364 – 150LLSPS…WFQGN → CFTCRTAPSLVMVLSWKSGV RREVPVHPSYAKY in isoform 2. 1 PublicationAdd BLAST87

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK055355 mRNA No translation available.
AL359944 mRNA Translation: CAB95774.1 Sequence problems.
CR749679 mRNA Translation: CAH18470.1 Sequence problems.
AC064853 Genomic DNA Translation: AAX93156.1
CH471063 Genomic DNA Translation: EAW70873.1
CH471063 Genomic DNA Translation: EAW70874.1
BC131618 mRNA Translation: AAI31619.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33388.1 [Q53S99-1]
CCDS54434.1 [Q53S99-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001155955.1, NM_001162483.1 [Q53S99-2]
NP_064546.3, NM_020161.3 [Q53S99-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000641422; ENSP00000493443; ENSG00000042304 [Q53S99-2]
ENST00000642055; ENSP00000493351; ENSG00000042304 [Q53S99-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56918

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56918

UCSC genome browser

More...
UCSCi
uc002vph.4 human [Q53S99-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055355 mRNA No translation available.
AL359944 mRNA Translation: CAB95774.1 Sequence problems.
CR749679 mRNA Translation: CAH18470.1 Sequence problems.
AC064853 Genomic DNA Translation: AAX93156.1
CH471063 Genomic DNA Translation: EAW70873.1
CH471063 Genomic DNA Translation: EAW70874.1
BC131618 mRNA Translation: AAI31619.1
CCDSiCCDS33388.1 [Q53S99-1]
CCDS54434.1 [Q53S99-2]
RefSeqiNP_001155955.1, NM_001162483.1 [Q53S99-2]
NP_064546.3, NM_020161.3 [Q53S99-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ53S99, 1 interactor
STRINGi9606.ENSP00000264387

PTM databases

iPTMnetiQ53S99

Polymorphism and mutation databases

BioMutaiC2orf83

Proteomic databases

PaxDbiQ53S99
PRIDEiQ53S99
ProteomicsDBi62534 [Q53S99-1]
7384

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
56918
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000641422; ENSP00000493443; ENSG00000042304 [Q53S99-2]
ENST00000642055; ENSP00000493351; ENSG00000042304 [Q53S99-1]
GeneIDi56918
KEGGihsa:56918
UCSCiuc002vph.4 human [Q53S99-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56918
DisGeNETi56918

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C2orf83
HGNCiHGNC:25344 C2orf83
HPAiHPA030319
neXtProtiNX_Q53S99
OpenTargetsiENSG00000042304
PharmGKBiPA164717149

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3810 Eukaryota
ENOG410XT34 LUCA
GeneTreeiENSGT00950000183022
HOGENOMiHOG000111339
InParanoidiQ53S99
OMAiGHGLCHP
OrthoDBi1405747at2759
PhylomeDBiQ53S99
TreeFamiTF341245

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56918

Pharos

More...
Pharosi
Q53S99

Protein Ontology

More...
PROi
PR:Q53S99

Gene expression databases

BgeeiENSG00000042304 Expressed in 24 organ(s), highest expression level in buccal mucosa cell
GenevisibleiQ53S99 HS

Family and domain databases

InterProiView protein in InterPro
IPR002666 Folate_carrier
PANTHERiPTHR10686 PTHR10686, 1 hit
PfamiView protein in Pfam
PF01770 Folate_carrier, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCB083_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53S99
Secondary accession number(s): A2RRG6, B8ZZI8, Q9NPW4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: May 24, 2005
Last modified: September 18, 2019
This is version 98 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again