Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (07 Oct 2020)
Sequence version 1 (24 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

FAST kinase domain-containing protein 1, mitochondrial

Gene

FASTKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the down-regulation of mitochondrial MT-ND3 mRNA levels which leads to decreased respiratory complex I abundance and activity.2 Publications

Caution

It is uncertain whether Met-1 or Met-15 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q53R41

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FAST kinase domain-containing protein 1, mitochondrial
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FASTKD1
Synonyms:KIAA1800
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138399.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26150, FASTKD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617529, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q53R41

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79675

MalaCards human disease database

More...
MalaCardsi
FASTKD1

Open Targets

More...
OpenTargetsi
ENSG00000138399

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145148834

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q53R41, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FASTKD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74726532

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – ?MitochondrionCurated
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000284710? – 847FAST kinase domain-containing protein 1, mitochondrial

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei360N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q53R41

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q53R41

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q53R41

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q53R41

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q53R41

PeptideAtlas

More...
PeptideAtlasi
Q53R41

PRoteomics IDEntifications database

More...
PRIDEi
Q53R41

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62517 [Q53R41-1]
62518 [Q53R41-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q53R41

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q53R41

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138399, Expressed in secondary oocyte and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q53R41, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q53R41, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000138399, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122800, 17 interactors

Protein interaction database and analysis system

More...
IntActi
Q53R41, 22 interactors

Molecular INTeraction database

More...
MINTi
Q53R41

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000400513

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q53R41, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q53R41

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini777 – 837RAPPROSITE-ProRule annotationAdd BLAST61

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RAP domain is essential to regulate MT-ND3 mRNA levels.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAST kinase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQ64, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182779

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017819_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q53R41

Identification of Orthologs from Complete Genome Data

More...
OMAi
HWESNTQ

Database of Orthologous Groups

More...
OrthoDBi
352329at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q53R41

TreeFam database of animal gene trees

More...
TreeFami
TF324885

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013579, FAST_2
IPR010622, FAST_Leu-rich
IPR013584, RAP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06743, FAST_1, 1 hit
PF08368, FAST_2, 1 hit
PF08373, RAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00952, RAP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51286, RAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q53R41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE
60 70 80 90 100
QMFGFIERNK AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT
110 120 130 140 150
LHNLATNKFK LMNDDTLVNV LYVTQQFAGE AHDPLVEALV TEAWRRLERF
160 170 180 190 200
DIKLLSEFSS CLADQHLYFS PLMGKIADIV HRNLETTQDL SSLSVLMVNI
210 220 230 240 250
SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN VRYRYQPLLE
260 270 280 290 300
RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC
310 320 330 340 350
NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD
360 370 380 390 400
MESRNSCLIK RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR
410 420 430 440 450
ELLLSYLKNS FIPTEVSVLV RAISLLPSPH LDEVGISRIE AVLPQCDLNN
460 470 480 490 500
LSSFATSVLR WIQHDHMYLD NMTAKQLKLL QKLDHYGRQR LQHSNSLDLL
510 520 530 540 550
RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA SFISSTDYLS
560 570 580 590 600
TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH
610 620 630 640 650
LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL
660 670 680 690 700
SPSRSARVQF HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ
710 720 730 740 750
QQIFKMLAEV LGGINCVKAS VLTPYYHKVD FECILDKRKK PLPYGSHNIA
760 770 780 790 800
LGQLPEMPWE SNIEIVGSRL PPGAERIALE FLDSKALCRN IPHMKGKSAM
810 820 830 840
KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF GEVKSCL
Length:847
Mass (Da):97,411
Last modified:May 24, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5026A635048EB0B3
GO
Isoform 2 (identifier: Q53R41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S

Show »
Length:804
Mass (Da):92,204
Checksum:i1026298B7060A369
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JMM4C9JMM4_HUMAN
FAST kinase domain-containing prote...
FASTKD1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTP4C9JTP4_HUMAN
FAST kinase domain-containing prote...
FASTKD1
276Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EW60E7EW60_HUMAN
FAST kinase domain-containing prote...
FASTKD1
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH32687 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15168 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti213V → M in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti228V → A in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti288M → T in BAB15168 (PubMed:14702039).Curated1
Sequence conflicti293L → P in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti756E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429 (PubMed:11347906).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031806384E → Q. Corresponds to variant dbSNP:rs12618227Ensembl.1
Natural variantiVAR_031807446C → G. Corresponds to variant dbSNP:rs35106223Ensembl.1
Natural variantiVAR_031808467M → V2 PublicationsCorresponds to variant dbSNP:rs2253680Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024617649 – 692ILSPS…QYNKG → S in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK025554 mRNA Translation: BAB15168.1 Different initiation.
AK055892 mRNA Translation: BAB71037.1
AK074302 mRNA Translation: BAB85043.1
AC093899 Genomic DNA Translation: AAY24118.1
BC032687 mRNA Translation: AAH32687.1 Different initiation.
AB058703 mRNA Translation: BAB47429.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33318.1 [Q53R41-1]
CCDS63051.1 [Q53R41-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001268405.1, NM_001281476.2 [Q53R41-2]
NP_001308975.1, NM_001322046.1 [Q53R41-1]
NP_001308977.1, NM_001322048.1
NP_001308978.1, NM_001322049.1
NP_078898.3, NM_024622.5 [Q53R41-1]
XP_016860400.1, XM_017004911.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000453153; ENSP00000400513; ENSG00000138399 [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399 [Q53R41-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79675

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79675

UCSC genome browser

More...
UCSCi
uc002uev.6, human [Q53R41-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025554 mRNA Translation: BAB15168.1 Different initiation.
AK055892 mRNA Translation: BAB71037.1
AK074302 mRNA Translation: BAB85043.1
AC093899 Genomic DNA Translation: AAY24118.1
BC032687 mRNA Translation: AAH32687.1 Different initiation.
AB058703 mRNA Translation: BAB47429.1
CCDSiCCDS33318.1 [Q53R41-1]
CCDS63051.1 [Q53R41-2]
RefSeqiNP_001268405.1, NM_001281476.2 [Q53R41-2]
NP_001308975.1, NM_001322046.1 [Q53R41-1]
NP_001308977.1, NM_001322048.1
NP_001308978.1, NM_001322049.1
NP_078898.3, NM_024622.5 [Q53R41-1]
XP_016860400.1, XM_017004911.1

3D structure databases

SMRiQ53R41
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122800, 17 interactors
IntActiQ53R41, 22 interactors
MINTiQ53R41
STRINGi9606.ENSP00000400513

PTM databases

iPTMnetiQ53R41
PhosphoSitePlusiQ53R41

Polymorphism and mutation databases

BioMutaiFASTKD1
DMDMi74726532

Proteomic databases

EPDiQ53R41
jPOSTiQ53R41
MassIVEiQ53R41
MaxQBiQ53R41
PaxDbiQ53R41
PeptideAtlasiQ53R41
PRIDEiQ53R41
ProteomicsDBi62517 [Q53R41-1]
62518 [Q53R41-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33812, 127 antibodies

The DNASU plasmid repository

More...
DNASUi
79675

Genome annotation databases

EnsembliENST00000453153; ENSP00000400513; ENSG00000138399 [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399 [Q53R41-2]
GeneIDi79675
KEGGihsa:79675
UCSCiuc002uev.6, human [Q53R41-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79675
DisGeNETi79675
EuPathDBiHostDB:ENSG00000138399.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FASTKD1
HGNCiHGNC:26150, FASTKD1
HPAiENSG00000138399, Low tissue specificity
MalaCardsiFASTKD1
MIMi617529, gene
neXtProtiNX_Q53R41
OpenTargetsiENSG00000138399
PharmGKBiPA145148834

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QQ64, Eukaryota
GeneTreeiENSGT00950000182779
HOGENOMiCLU_017819_0_0_1
InParanoidiQ53R41
OMAiHWESNTQ
OrthoDBi352329at2759
PhylomeDBiQ53R41
TreeFamiTF324885

Enzyme and pathway databases

PathwayCommonsiQ53R41

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79675, 6 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FASTKD1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79675
PharosiQ53R41, Tdark

Protein Ontology

More...
PROi
PR:Q53R41
RNActiQ53R41, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138399, Expressed in secondary oocyte and 236 other tissues
ExpressionAtlasiQ53R41, baseline and differential
GenevisibleiQ53R41, HS

Family and domain databases

InterProiView protein in InterPro
IPR013579, FAST_2
IPR010622, FAST_Leu-rich
IPR013584, RAP
PfamiView protein in Pfam
PF06743, FAST_1, 1 hit
PF08368, FAST_2, 1 hit
PF08373, RAP, 1 hit
SMARTiView protein in SMART
SM00952, RAP, 1 hit
PROSITEiView protein in PROSITE
PS51286, RAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAKD1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53R41
Secondary accession number(s): Q8N583
, Q8TEA9, Q96JM5, Q96N71, Q9H6T4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: May 24, 2005
Last modified: October 7, 2020
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again