UniProtKB - Q53HI1 (UNC50_HUMAN)

BLAST

>sp|Q53HI1|UNC50_HUMAN Protein unc-50 homolog OS=Homo sapiens OX=9606 GN=UNC50 PE=1 SV=2
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP
QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI
DCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN
HVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL
ALGWNFTHTLCSFYKYRVK

Align
Format
Add to basket Added to basket
History
Entry version 93 (12 Sep 2018)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Protein unc-50 homolog

Gene

UNC50

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).By similarity

GO - Molecular functionⁱ

RNA binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

protein transport Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	RNA-binding
Biological process	Protein transport, Transport

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Protein unc-50 homolog Alternative name(s): Periodontal ligament-specific protein 22 Short name: PDLs22 Protein GMH1 homolog Short name: hGMH1 Uncoordinated-like protein
Gene namesⁱ	Name:UNC50 Synonyms:UNCL ORF Names:HSD-23, HSD23
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000115446.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:16046 UNC50
MIMⁱ	617826 gene
neXtProtⁱ	NX_Q53HI1

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 82	CytoplasmicSequence analysisAdd BLAST	82
Transmembraneⁱ	83 – 103	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	104 – 115	LumenalSequence analysisAdd BLAST	12
Transmembraneⁱ	116 – 136	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	137 – 163	CytoplasmicSequence analysisAdd BLAST	27
Transmembraneⁱ	164 – 184	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	185 – 187	LumenalSequence analysis	3
Transmembraneⁱ	188 – 208	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	209 – 222	CytoplasmicSequence analysisAdd BLAST	14
Transmembraneⁱ	223 – 243	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	244 – 259	LumenalSequence analysisAdd BLAST	16

Keywords - Cellular componentⁱ

Golgi apparatus, Membrane, Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	25972
Open Targets More...OpenTargetsⁱ	ENSG00000115446
PharmGKBⁱ	PA134984566

Polymorphism and mutation databases

BioMutaⁱ	UNC50
DMDMⁱ	160358938

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000308961	1 – 259	Protein unc-50 homologAdd BLAST		259

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	1	N-acetylmethionineCombined sources1 Publication		1
Modified residueⁱ	6	PhosphoserineCombined sources		1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	Q53HI1
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q53HI1
PaxDbⁱ	Q53HI1
PeptideAtlas More...PeptideAtlasⁱ	Q53HI1
PRIDEⁱ	Q53HI1
ProteomicsDBⁱ	62506

PTM databases

iPTMnetⁱ	Q53HI1
PhosphoSitePlusⁱ	Q53HI1

Expressionⁱ

Tissue specificityⁱ

Present in periodontal ligament fibroblasts (at protein level).1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000115446 Expressed in 232 organ(s), highest expression level in left lobe of thyroid gland
CleanExⁱ	HS_UNC50
ExpressionAtlasⁱ	Q53HI1 baseline and differential
Genevisibleⁱ	Q53HI1 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA027009

HPAⁱ

HPA027009

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	117456, 5 interactors
IntActⁱ	Q53HI1, 26 interactors
Molecular INTeraction database More...MINTⁱ	Q53HI1
STRINGⁱ	9606.ENSP00000350409

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q53HI1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the unc-50 family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG3012 Eukaryota ENOG410XT05 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000018553
HOVERGENⁱ	HBG053013
InParanoidⁱ	Q53HI1
PhylomeDBⁱ	Q53HI1
TreeFamⁱ	TF105624

Family and domain databases

InterProⁱ	View protein in InterPro IPR007881 UNC-50
PANTHERⁱ	PTHR12841 PTHR12841, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF05216 UNC-50, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q53HI1-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLPSTSVNSL VQGNGVLNSR DAARHTAGAK RYKYLRRLFR FRQMDFEFAA 
        60         70         80         90        100
WQMLYLFTSP QRVYRNFHYR KQTKDQWARD DPAFLVLLSI WLCVSTIGFG 
       110        120        130        140        150
FVLDMGFFET IKLLLWVVLI DCVGVGLLIA TLMWFISNKY LVKRQSRDYD 
       160        170        180        190        200
VEWGYAFDVH LNAFYPLLVI LHFIQLFFIN HVILTDTFIG YLVGNTLWLV 
       210        220        230        240        250
AVGYYIYVTF LGYSALPFLK NTVILLYPFA PLILLYGLSL ALGWNFTHTL 

CSFYKYRVK

Length:259

Mass (Da):30,373

Last modified:November 13, 2007 - v2

Checksum:ⁱF0BAF2594B84330B

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

J3KQ47	J3KQ47_HUMAN	Protein unc-50 homolog Protein unc-50 homolog	UNC50	276	Annotation score:
H7C3J5	H7C3J5_HUMAN	Protein unc-50 homolog Protein unc-50 homolog	UNC50	92	Annotation score:
H7BYK3	H7BYK3_HUMAN	Protein unc-50 homolog Protein unc-50 homolog	UNC50	128	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	34	Y → C in AAP20057 (Ref. 4) Curated	1
Sequence conflictⁱ	66	N → S in BAD96319 (Ref. 6) Curated	1
Sequence conflictⁱ	115	L → P in AAH39078 (PubMed:15489334).Curated	1
Sequence conflictⁱ	119	L → F in BAD96319 (Ref. 6) Curated	1
Sequence conflictⁱ	173	F → L in AAK08987 (Ref. 1) Curated	1
Sequence conflictⁱ	173	F → L in CAB45714 (PubMed:11230166).Curated	1
Sequence conflictⁱ	173	F → L in CAG38495 (Ref. 5) Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY017215 mRNA Translation: AAK08987.1 AF077038 mRNA Translation: AAD27771.1 AL080115 mRNA Translation: CAB45714.1 AY251534 mRNA Translation: AAP20057.1 CR533464 mRNA Translation: CAG38495.1 AK222599 mRNA Translation: BAD96319.1 AC010134 Genomic DNA Translation: AAX93232.1 AC064860 Genomic DNA Translation: AAY14975.1 CH471127 Genomic DNA Translation: EAX01900.1 CH471127 Genomic DNA Translation: EAX01901.1 CH471127 Genomic DNA Translation: EAX01902.1 BC017019 mRNA Translation: AAH17019.1 BC025992 mRNA Translation: AAH25992.1 BC039078 mRNA Translation: AAH39078.1 BC091481 mRNA Translation: AAH91481.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2035.1
PIRⁱ	T12451
NCBI Reference Sequences More...RefSeqⁱ	NP_054763.2, NM_014044.6
UniGeneⁱ	Hs.13370

Genome annotation databases

Ensemblⁱ	ENST00000357765; ENSP00000350409; ENSG00000115446
GeneIDⁱ	25972
KEGGⁱ	hsa:25972
UCSC genome browser More...UCSCⁱ	uc002szc.5 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q53HI1	Unc-50 inner nuclear membrane RNA binding protein		PANTR		281	UniRef100_Q53HI1
Uncharacterized protein		PANPA		281
Unc-50 inner nuclear membrane RNA binding protein		GORGO		281
Unc-50-like protein isoform 1 (Fragment)		HUMAN		259
UNC50 isoform 4		PANTR		259
+1

Protein	Similar proteins		Species	Score	Length	Source
Q53HI1	Protein unc-50 homolog		RAT		259	UniRef90_O55227
Protein unc-50 homolog		BOVIN		259
Protein unc-50 homolog		MOUSE		259
Uncharacterized protein		MACMU		281
Uncharacterized protein		MACFA		281
+138

Protein	Similar proteins		Species	Score	Length	Source
Q53HI1	Protein unc-50 homolog		RAT		259	UniRef50_O55227
Protein unc-50 homolog		BOVIN		259
Protein unc-50 homolog		MOUSE		259
Protein unc-50 homolog A		XENLA		259
Uncharacterized protein		NOMLE		281
+241

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY017215 mRNA Translation: AAK08987.1 AF077038 mRNA Translation: AAD27771.1 AL080115 mRNA Translation: CAB45714.1 AY251534 mRNA Translation: AAP20057.1 CR533464 mRNA Translation: CAG38495.1 AK222599 mRNA Translation: BAD96319.1 AC010134 Genomic DNA Translation: AAX93232.1 AC064860 Genomic DNA Translation: AAY14975.1 CH471127 Genomic DNA Translation: EAX01900.1 CH471127 Genomic DNA Translation: EAX01901.1 CH471127 Genomic DNA Translation: EAX01902.1 BC017019 mRNA Translation: AAH17019.1 BC025992 mRNA Translation: AAH25992.1 BC039078 mRNA Translation: AAH39078.1 BC091481 mRNA Translation: AAH91481.1
CCDSⁱ	CCDS2035.1
PIRⁱ	T12451
RefSeqⁱ	NP_054763.2, NM_014044.6
UniGeneⁱ	Hs.13370

3D structure databases

ProteinModelPortalⁱ	Q53HI1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	117456, 5 interactors
IntActⁱ	Q53HI1, 26 interactors
MINTⁱ	Q53HI1
STRINGⁱ	9606.ENSP00000350409

PTM databases

iPTMnetⁱ	Q53HI1
PhosphoSitePlusⁱ	Q53HI1

Polymorphism and mutation databases

BioMutaⁱ	UNC50
DMDMⁱ	160358938

Proteomic databases

EPDⁱ	Q53HI1
MaxQBⁱ	Q53HI1
PaxDbⁱ	Q53HI1
PeptideAtlasⁱ	Q53HI1
PRIDEⁱ	Q53HI1
ProteomicsDBⁱ	62506

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	25972
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000357765; ENSP00000350409; ENSG00000115446
GeneIDⁱ	25972
KEGGⁱ	hsa:25972
UCSCⁱ	uc002szc.5 human

Organism-specific databases

CTDⁱ	25972
DisGeNETⁱ	25972
EuPathDBⁱ	HostDB:ENSG00000115446.11
GeneCardsⁱ	UNC50
H-InvDBⁱ	HIX0002299
HGNCⁱ	HGNC:16046 UNC50
HPAⁱ	HPA027009
MIMⁱ	617826 gene
neXtProtⁱ	NX_Q53HI1
OpenTargetsⁱ	ENSG00000115446
PharmGKBⁱ	PA134984566
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3012 Eukaryota ENOG410XT05 LUCA
GeneTreeⁱ	ENSGT00390000018553
HOVERGENⁱ	HBG053013
InParanoidⁱ	Q53HI1
PhylomeDBⁱ	Q53HI1
TreeFamⁱ	TF105624

Miscellaneous databases

ChiTaRSⁱ	UNC50 human
GenomeRNAiⁱ	25972
Protein Ontology More...PROⁱ	PR:Q53HI1
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000115446 Expressed in 232 organ(s), highest expression level in left lobe of thyroid gland
CleanExⁱ	HS_UNC50
ExpressionAtlasⁱ	Q53HI1 baseline and differential
Genevisibleⁱ	Q53HI1 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR007881 UNC-50
PANTHERⁱ	PTHR12841 PTHR12841, 1 hit
Pfamⁱ	View protein in Pfam PF05216 UNC-50, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	UNC50_HUMAN
Accessionⁱ	Q53HI1Primary (citable) accession number: Q53HI1 Secondary accession number(s): D3DVH4 Q9Y4S6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 13, 2007
	Last sequence update:	November 13, 2007
	Last modified:	September 12, 2018
	This is version 93 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q53HI1 (UNC50_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Protein unc-50 homolog

UNC50

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Golgi apparatus

Golgi apparatus

Nucleus

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ