Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (05 Jun 2019)
Sequence version 2 (21 Feb 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

U4/U6.U5 tri-snRNP-associated protein 2

Gene

USP39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP, one of the building blocks of the precatalytic spliceosome (PubMed:11350945, PubMed:26912367). Regulates AURKB mRNA levels, and thereby plays a role in cytokinesis and in the spindle checkpoint. Does not have ubiquitin-specific peptidase activity (PubMed:18728397).3 Publications

Caution

Lacks the conserved His and Cys residues that are essential for the activity of de-ubiquitinating enzymes. Lacks ubiquitin C-terminal hydrolase activity (PubMed:18728397).1 Publication1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri122 – 183UBP-typePROSITE-ProRule annotationAdd BLAST62

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • mRNA processing Source: ProtInc
  • mRNA splicing, via spliceosome Source: UniProtKB
  • protein deubiquitination Source: InterPro
  • RNA splicing Source: ProtInc
  • spliceosomal complex assembly Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, mRNA processing, mRNA splicing
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-72163 mRNA Splicing - Major Pathway

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C19.972

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
U4/U6.U5 tri-snRNP-associated protein 2
Alternative name(s):
Inactive ubiquitin-specific peptidase 391 Publication
SAD1 homolog1 Publication
U4/U6.U5 tri-snRNP-associated 65 kDa protein1 Publication
Short name:
65K1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:USP39
ORF Names:CGI-21, HSPC332, PRO2855
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20071 USP39

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611594 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q53GS9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10713

Open Targets

More...
OpenTargetsi
ENSG00000168883

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134905136

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
USP39

Domain mapping of disease mutations (DMDM)

More...
DMDMi
88909655

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002239621 – 565U4/U6.U5 tri-snRNP-associated protein 2Add BLAST565

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei46PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki51Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei82PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q53GS9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q53GS9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q53GS9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q53GS9

PeptideAtlas

More...
PeptideAtlasi
Q53GS9

PRoteomics IDEntifications database

More...
PRIDEi
Q53GS9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62489

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q53GS9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q53GS9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q53GS9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168883 Expressed in 212 organ(s), highest expression level in gastrocnemius

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q53GS9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q53GS9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034823

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The U4/U6-U5 tri-snRNP complex is a building block of the precatalytic spliceosome (spliceosome B complex) (PubMed:11350945, PubMed:26912367). Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, SNRPG, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39, plus LSM2, LSM3, LSM4, LSM5, LSM6, LSM7 and LSM8 (PubMed:16723661, PubMed:26912367).3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115939, 106 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q53GS9

Protein interaction database and analysis system

More...
IntActi
Q53GS9, 48 interactors

Molecular INTeraction database

More...
MINTi
Q53GS9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312981

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q53GS9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini225 – 555USPAdd BLAST331

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4 – 103Arg-richAdd BLAST100

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C19 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri122 – 183UBP-typePROSITE-ProRule annotationAdd BLAST62

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2026 Eukaryota
ENOG410XS41 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007992

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000188754

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q53GS9

KEGG Orthology (KO)

More...
KOi
K12847

Identification of Orthologs from Complete Genome Data

More...
OMAi
CNVVLHA

Database of Orthologous Groups

More...
OrthoDBi
931188at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q53GS9

TreeFam database of animal gene trees

More...
TreeFami
TF300610

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02669 Peptidase_C19M, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038765 Papain-like_cys_pep_sf
IPR001394 Peptidase_C19_UCH
IPR033809 USP39
IPR028889 USP_dom
IPR013083 Znf_RING/FYVE/PHD
IPR001607 Znf_UBP

The PANTHER Classification System

More...
PANTHERi
PTHR21646:SF16 PTHR21646:SF16, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00443 UCH, 1 hit
PF02148 zf-UBP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00290 ZnF_UBP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54001 SSF54001, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50235 USP_3, 1 hit
PS50271 ZF_UBP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q53GS9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGRSKRESR GSTRGKRESE SRGSSGRVKR ERDREREPEA ASSRGSPVRV
60 70 80 90 100
KREFEPASAR EAPASVVPFV RVKREREVDE DSEPEREVRA KNGRVDSEDR
110 120 130 140 150
RSRHCPYLDT INRSVLDFDF EKLCSISLSH INAYACLVCG KYFQGRGLKS
160 170 180 190 200
HAYIHSVQFS HHVFLNLHTL KFYCLPDNYE IIDSSLEDIT YVLKPTFTKQ
210 220 230 240 250
QIANLDKQAK LSRAYDGTTY LPGIVGLNNI KANDYANAVL QALSNVPPLR
260 270 280 290 300
NYFLEEDNYK NIKRPPGDIM FLLVQRFGEL MRKLWNPRNF KAHVSPHEML
310 320 330 340 350
QAVVLCSKKT FQITKQGDGV DFLSWFLNAL HSALGGTKKK KKTIVTDVFQ
360 370 380 390 400
GSMRIFTKKL PHPDLPAEEK EQLLHNDEYQ ETMVESTFMY LTLDLPTAPL
410 420 430 440 450
YKDEKEQLII PQVPLFNILA KFNGITEKEY KTYKENFLKR FQLTKLPPYL
460 470 480 490 500
IFCIKRFTKN NFFVEKNPTI VNFPITNVDL REYLSEEVQA VHKNTTYDLI
510 520 530 540 550
ANIVHDGKPS EGSYRIHVLH HGTGKWYELQ DLQVTDILPQ MITLSEAYIQ
560
IWKRRDNDET NQQGA
Length:565
Mass (Da):65,381
Last modified:February 21, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8946FD5DCDEFD0B0
GO
Isoform 2 (identifier: Q53GS9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSGRSKRESR...EDSEPEREVR → MLTAVPSHLFS
     113-144: RSVLDFDFEKLCSISLSHINAYACLVCGKYFQ → SFSPFPT

Show »
Length:462
Mass (Da):53,510
Checksum:iC57BF48DC1B0F9D5
GO
Isoform 3 (identifier: Q53GS9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-565: NVDLREYLSE...DNDETNQQGA → GQANGMNYKTSR

Show »
Length:488
Mass (Da):56,359
Checksum:i757387284D021074
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X1B2A0A087X1B2_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
487Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B9A018B9A018_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
536Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JIU2C9JIU2_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0X5C9J0X5_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC91F8WC91_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WW31A0A087WW31_HUMAN
U4/U6.U5 tri-snRNP-associated prote...
USP39
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD27730 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAG35521 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13T → I in BAD96572 (Ref. 4) Curated1
Sequence conflicti135A → V in BAD96572 (Ref. 4) Curated1
Sequence conflicti277F → S in BAG50852 (PubMed:14702039).Curated1
Sequence conflicti280L → P in BAG50852 (PubMed:14702039).Curated1
Sequence conflicti294V → A in BAG50852 (PubMed:14702039).Curated1
Sequence conflicti400L → F in AAK49524 (PubMed:11350945).Curated1
Sequence conflicti456R → I in AAD27730 (PubMed:10810093).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451671 – 89MSGRS…EREVR → MLTAVPSHLFS in isoform 2. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_045168113 – 144RSVLD…GKYFQ → SFSPFPT in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_046822477 – 565NVDLR…NQQGA → GQANGMNYKTSR in isoform 3. 1 PublicationAdd BLAST89

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF353989 mRNA Translation: AAK49524.1
AF132955 mRNA Translation: AAD27730.1 Frameshift.
AK289451 mRNA Translation: BAF82140.1
AK001047 mRNA Translation: BAG50852.1
AK295257 mRNA Translation: BAG58246.1
AK222852 mRNA Translation: BAD96572.1
AC012454 Genomic DNA No translation available.
AC016753 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99490.1
CH471053 Genomic DNA Translation: EAW99492.1
CH471053 Genomic DNA Translation: EAW99493.1
CH471053 Genomic DNA Translation: EAW99494.1
BC001384 mRNA Translation: AAH01384.2
BC067273 mRNA Translation: AAH67273.1
AF130096 mRNA Translation: AAG35521.1 Different initiation.
AF161450 mRNA Translation: AAF29010.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33234.1 [Q53GS9-1]
CCDS58716.1 [Q53GS9-2]
CCDS58717.1 [Q53GS9-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001243654.1, NM_001256725.1 [Q53GS9-1]
NP_001243655.1, NM_001256726.1 [Q53GS9-3]
NP_001243656.1, NM_001256727.1
NP_001243657.1, NM_001256728.1 [Q53GS9-2]
NP_006581.2, NM_006590.3 [Q53GS9-1]
XP_006711985.1, XM_006711922.1
XP_006711986.1, XM_006711923.2
XP_011530789.1, XM_011532487.1
XP_011530790.1, XM_011532488.1
XP_016858671.1, XM_017003182.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000323701; ENSP00000312981; ENSG00000168883 [Q53GS9-1]
ENST00000409470; ENSP00000386864; ENSG00000168883 [Q53GS9-1]
ENST00000409766; ENSP00000386803; ENSG00000168883 [Q53GS9-3]
ENST00000450066; ENSP00000396133; ENSG00000168883 [Q53GS9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10713

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10713

UCSC genome browser

More...
UCSCi
uc002sqe.5 human [Q53GS9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF353989 mRNA Translation: AAK49524.1
AF132955 mRNA Translation: AAD27730.1 Frameshift.
AK289451 mRNA Translation: BAF82140.1
AK001047 mRNA Translation: BAG50852.1
AK295257 mRNA Translation: BAG58246.1
AK222852 mRNA Translation: BAD96572.1
AC012454 Genomic DNA No translation available.
AC016753 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99490.1
CH471053 Genomic DNA Translation: EAW99492.1
CH471053 Genomic DNA Translation: EAW99493.1
CH471053 Genomic DNA Translation: EAW99494.1
BC001384 mRNA Translation: AAH01384.2
BC067273 mRNA Translation: AAH67273.1
AF130096 mRNA Translation: AAG35521.1 Different initiation.
AF161450 mRNA Translation: AAF29010.1
CCDSiCCDS33234.1 [Q53GS9-1]
CCDS58716.1 [Q53GS9-2]
CCDS58717.1 [Q53GS9-3]
RefSeqiNP_001243654.1, NM_001256725.1 [Q53GS9-1]
NP_001243655.1, NM_001256726.1 [Q53GS9-3]
NP_001243656.1, NM_001256727.1
NP_001243657.1, NM_001256728.1 [Q53GS9-2]
NP_006581.2, NM_006590.3 [Q53GS9-1]
XP_006711985.1, XM_006711922.1
XP_006711986.1, XM_006711923.2
XP_011530789.1, XM_011532487.1
XP_011530790.1, XM_011532488.1
XP_016858671.1, XM_017003182.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3JCRelectron microscopy7.00V1-565[»]
6AH0electron microscopy5.70W1-565[»]
6QW6electron microscopy2.92U1-555[»]
6QX9electron microscopy3.28U1-555[»]
SMRiQ53GS9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115939, 106 interactors
CORUMiQ53GS9
IntActiQ53GS9, 48 interactors
MINTiQ53GS9
STRINGi9606.ENSP00000312981

Protein family/group databases

MEROPSiC19.972

PTM databases

iPTMnetiQ53GS9
PhosphoSitePlusiQ53GS9
SwissPalmiQ53GS9

Polymorphism and mutation databases

BioMutaiUSP39
DMDMi88909655

Proteomic databases

EPDiQ53GS9
jPOSTiQ53GS9
MaxQBiQ53GS9
PaxDbiQ53GS9
PeptideAtlasiQ53GS9
PRIDEiQ53GS9
ProteomicsDBi62489

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000323701; ENSP00000312981; ENSG00000168883 [Q53GS9-1]
ENST00000409470; ENSP00000386864; ENSG00000168883 [Q53GS9-1]
ENST00000409766; ENSP00000386803; ENSG00000168883 [Q53GS9-3]
ENST00000450066; ENSP00000396133; ENSG00000168883 [Q53GS9-2]
GeneIDi10713
KEGGihsa:10713
UCSCiuc002sqe.5 human [Q53GS9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10713
DisGeNETi10713

GeneCards: human genes, protein and diseases

More...
GeneCardsi
USP39
HGNCiHGNC:20071 USP39
HPAiHPA034823
MIMi611594 gene
neXtProtiNX_Q53GS9
OpenTargetsiENSG00000168883
PharmGKBiPA134905136

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2026 Eukaryota
ENOG410XS41 LUCA
GeneTreeiENSGT00390000007992
HOGENOMiHOG000188754
InParanoidiQ53GS9
KOiK12847
OMAiCNVVLHA
OrthoDBi931188at2759
PhylomeDBiQ53GS9
TreeFamiTF300610

Enzyme and pathway databases

ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
USP39 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
USP39

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10713

Protein Ontology

More...
PROi
PR:Q53GS9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168883 Expressed in 212 organ(s), highest expression level in gastrocnemius
ExpressionAtlasiQ53GS9 baseline and differential
GenevisibleiQ53GS9 HS

Family and domain databases

CDDicd02669 Peptidase_C19M, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR038765 Papain-like_cys_pep_sf
IPR001394 Peptidase_C19_UCH
IPR033809 USP39
IPR028889 USP_dom
IPR013083 Znf_RING/FYVE/PHD
IPR001607 Znf_UBP
PANTHERiPTHR21646:SF16 PTHR21646:SF16, 1 hit
PfamiView protein in Pfam
PF00443 UCH, 1 hit
PF02148 zf-UBP, 1 hit
SMARTiView protein in SMART
SM00290 ZnF_UBP, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS50235 USP_3, 1 hit
PS50271 ZF_UBP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNUT2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53GS9
Secondary accession number(s): A8K086
, B3KM40, B4DHT4, D6W5L4, G5E9H0, Q6NX47, Q96RK9, Q9BV89, Q9H381, Q9P050, Q9Y310
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: February 21, 2006
Last modified: June 5, 2019
This is version 141 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again