Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q53F39 (MPPE1_HUMAN)

Entry version 122 (02 Dec 2020)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Metallophosphoesterase 1

Gene

MPPE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metallophosphoesterase required for transport of GPI-anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins.2 Publications

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+1 PublicationNote: Binds 2 manganese ions per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi77Divalent metal cation 2Curated1
Metal bindingi119Divalent metal cation 1Curated1
Metal bindingi119Divalent metal cation 2Curated1
Metal bindingi157Divalent metal cation 1Curated1
Metal bindingi249Divalent metal cation 1Curated1
Metal bindingi303Divalent metal cation 1Curated1
Metal bindingi305Divalent metal cation 2Curated1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processER-Golgi transport, GPI-anchor biosynthesis, Transport
LigandManganese, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q53F39

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Metallophosphoesterase 1Curated (EC:3.1.-.-)
Alternative name(s):
Post-GPI attachment to proteins factor 51 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPPE1Imported
Synonyms:PGAP51 Publication
ORF Names:PP579
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000154889.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:15988, MPPE1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611900, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q53F39

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei27 – 47HelicalSequence analysisAdd BLAST21
Transmembranei356 – 376HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi77D → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi79H → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi119D → A or N: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi157N → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi158H → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi249H → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi303H → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi305H → A: Affects transport of GPI-anchor proteins. 1 Publication1
Mutagenesisi392 – 394KRK → ARA: Affects subcellular localization. 1 Publication3

Organism-specific databases

DisGeNET

More...DisGeNETi		65258

Open Targets

More...OpenTargetsi		ENSG00000154889

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134913534

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q53F39, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MPPE1

Domain mapping of disease mutations (DMDM)

More...DMDMi		215274110

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003157271 – 396Metallophosphoesterase 1Add BLAST396

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q53F39

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q53F39

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q53F39

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q53F39

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q53F39

PeptideAtlas

More...PeptideAtlasi		Q53F39

PRoteomics IDEntifications database

More...PRIDEi		Q53F39

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		62456 [Q53F39-1]
62457 [Q53F39-2]
62458 [Q53F39-3]
62459 [Q53F39-4]
62460 [Q53F39-5]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q53F39, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q53F39

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q53F39

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000154889, Expressed in caudate nucleus and 234 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q53F39, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q53F39, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000154889, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GPI-anchor proteins.

Interacts with TMED10.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		122415, 80 interactors

Protein interaction database and analysis system

More...IntActi		Q53F39, 72 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000465894

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q53F39, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q53F39

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi392 – 396Di-lysine motif5

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The di-lysine motif (KxKxx) acts as an endoplasmic reticulum retrieval signal.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the metallophosphoesterase superfamily. MPPE1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3662, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000013236

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q53F39

Identification of Orthologs from Complete Genome Data

More...OMAi		RTLHCMK

Database of Orthologous Groups

More...OrthoDBi		1094620at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q53F39

Family and domain databases

Conserved Domains Database

More...CDDi		cd08165, MPP_MPPE1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.60.21.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004843, Calcineurin-like_PHP_ApaH
IPR029052, Metallo-depent_PP-like
IPR039541, MPP_MPPE1
IPR033308, PGAP5/Cdc1/Ted1

The PANTHER Classification System

More...PANTHERi		PTHR13315, PTHR13315, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00149, Metallophos, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q53F39-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMIELGFGR QNFHPLKRKS SLLLKLIAVV FAVLLFCEFL IYYLAIFQCN 
        60         70         80         90        100
WPEVKTTASD GEQTTREPVL KAMFLADTHL LGEFLGHWLD KLRREWQMER 
       110        120        130        140        150
AFQTALWLLQ PEVVFILGDI FDEGKWSTPE AWADDVERFQ KMFRHPSHVQ 
       160        170        180        190        200
LKVVAGNHDI GFHYEMNTYK VERFEKVFSS ERLFSWKGIN FVMVNSVALN 
       210        220        230        240        250
GDGCGICSET EAELIEVSHR LNCSREARGS SRCGPGPLLP TSAPVLLQHY 
       260        270        280        290        300
PLYRRSDANC SGEDAAPAEE RDIPFKENYD VLSREASQKL LWWLQPRLVL 
       310        320        330        340        350
SGHTHSACEV HHGGRVPELS VPSFSWRNRN NPSFIMGSIT PTDYTLSKCY 
       360        370        380        390 
LPREDVVLII YCGVVGFLVV LTLTHFGLLA SPFLSGLNLL GKRKTR
Length:396
Mass (Da):45,141
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD117BCDB1630560A
GO
Isoform 2 (identifier: Q53F39-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

Show »
Length:340
Mass (Da):38,933
Checksum:i3F0B26CB0C48B354
GO
Isoform 3 (identifier: Q53F39-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-226: E → EQ
     338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

Show »
Length:341
Mass (Da):39,061
Checksum:i39DED2417CD4BBD4
GO
Isoform 4 (identifier: Q53F39-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-289: Missing.

Show »
Length:333
Mass (Da):38,270
Checksum:i6691B3999DC34E9E
GO
Isoform 5 (identifier: Q53F39-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-256: ARGSSRCGPGPLLPTSAPVLLQHYPLYRRS → VGEHLNATGAFCPVLLRFGCSLSPLALLAL
     257-396: Missing.

Show »
Length:256
Mass (Da):29,351
Checksum:i4BBDA145C3984B9D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MR93A0A0A0MR93_HUMAN
Metallophosphoesterase 1
MPPE1
374Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ES91K7ES91_HUMAN
Metallophosphoesterase 1
MPPE1
308Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQV4K7EQV4_HUMAN
Metallophosphoesterase 1
MPPE1
178Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQ70K7EQ70_HUMAN
Metallophosphoesterase 1
MPPE1
164Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DH11A0A0C4DH11_HUMAN
Metallophosphoesterase 1
MPPE1
243Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EM03K7EM03_HUMAN
Metallophosphoesterase 1
MPPE1
172Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIQ0K7EIQ0_HUMAN
Metallophosphoesterase 1
MPPE1
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESB8K7ESB8_HUMAN
Metallophosphoesterase 1
MPPE1
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJU0K7EJU0_HUMAN
Metallophosphoesterase 1
MPPE1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER13K7ER13_HUMAN
Metallophosphoesterase 1
MPPE1
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13863 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB14378 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22L → S in BAB14378 (PubMed:14702039).Curated1
Sequence conflicti32A → T in BAB14378 (PubMed:14702039).Curated1
Sequence conflicti97Q → R in AAL55744 (PubMed:15498874).Curated1
Sequence conflicti301S → I in AAH73994 (PubMed:15489334).Curated1
Sequence conflicti364V → E in AAM00279 (PubMed:11978971).Curated1
Sequence conflicti364V → E in AAM00277 (PubMed:11978971).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038294138R → Q. Corresponds to variant dbSNP:rs11872520Ensembl.1
Natural variantiVAR_038295197V → M. Corresponds to variant dbSNP:rs35611363Ensembl.1
Natural variantiVAR_038296268A → P4 PublicationsCorresponds to variant dbSNP:rs662515Ensembl.1
Natural variantiVAR_038297336M → L. Corresponds to variant dbSNP:rs16976814Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030679226E → EQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_030680227 – 289Missing in isoform 4. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_030681227 – 256ARGSS…LYRRS → VGEHLNATGAFCPVLLRFGC SLSPLALLAL in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_030682257 – 396Missing in isoform 5. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_030683338 – 396SITPT…KRKTR → TDA in isoform 2 and isoform 3. 4 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF363483, AF363482 Genomic DNA Translation: AAM00277.1
AF363483, AF363482 Genomic DNA Translation: AAM00278.1
AF363484 mRNA Translation: AAM00279.1
AK021647 mRNA Translation: BAB13863.1 Different initiation.
AK023052 mRNA Translation: BAB14378.1 Frameshift.
AK223450 mRNA Translation: BAD97170.1
AF289560 mRNA Translation: AAL55744.1
EF444996 Genomic DNA Translation: ACA06017.1
EF444996 Genomic DNA Translation: ACA06018.1
EF444996 Genomic DNA Translation: ACA06019.1
AP001269 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01562.1
CH471113 Genomic DNA Translation: EAX01565.1
CH471113 Genomic DNA Translation: EAX01564.1
CH471113 Genomic DNA Translation: EAX01569.1
CH471113 Genomic DNA Translation: EAX01571.1
CH471113 Genomic DNA Translation: EAX01567.1
CH471113 Genomic DNA Translation: EAX01568.1
BC002877 mRNA Translation: AAH02877.1
BC073994 mRNA Translation: AAH73994.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11853.1 [Q53F39-1]
CCDS56054.1 [Q53F39-4]

NCBI Reference Sequences

More...RefSeqi		NP_001229833.1, NM_001242904.1 [Q53F39-4]
NP_001306083.1, NM_001319154.1 [Q53F39-4]
NP_075563.3, NM_023075.5 [Q53F39-1]
XP_006722409.1, XM_006722346.2 [Q53F39-1]
XP_011524034.1, XM_011525732.1 [Q53F39-3]
XP_016881411.1, XM_017025922.1 [Q53F39-1]
XP_016881412.1, XM_017025923.1 [Q53F39-1]
XP_016881413.1, XM_017025924.1 [Q53F39-1]
XP_016881414.1, XM_017025925.1 [Q53F39-1]
XP_016881415.1, XM_017025926.1 [Q53F39-1]
XP_016881419.1, XM_017025930.1 [Q53F39-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000309976; ENSP00000311200; ENSG00000154889 [Q53F39-4]
ENST00000317235; ENSP00000327257; ENSG00000154889 [Q53F39-4]
ENST00000496196; ENSP00000433950; ENSG00000154889 [Q53F39-2]
ENST00000588072; ENSP00000465894; ENSG00000154889 [Q53F39-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		65258

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:65258

UCSC genome browser

More...UCSCi		uc002kqf.5, human [Q53F39-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF363483, AF363482 Genomic DNA Translation: AAM00277.1
AF363483, AF363482 Genomic DNA Translation: AAM00278.1
AF363484 mRNA Translation: AAM00279.1
AK021647 mRNA Translation: BAB13863.1 Different initiation.
AK023052 mRNA Translation: BAB14378.1 Frameshift.
AK223450 mRNA Translation: BAD97170.1
AF289560 mRNA Translation: AAL55744.1
EF444996 Genomic DNA Translation: ACA06017.1
EF444996 Genomic DNA Translation: ACA06018.1
EF444996 Genomic DNA Translation: ACA06019.1
AP001269 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01562.1
CH471113 Genomic DNA Translation: EAX01565.1
CH471113 Genomic DNA Translation: EAX01564.1
CH471113 Genomic DNA Translation: EAX01569.1
CH471113 Genomic DNA Translation: EAX01571.1
CH471113 Genomic DNA Translation: EAX01567.1
CH471113 Genomic DNA Translation: EAX01568.1
BC002877 mRNA Translation: AAH02877.1
BC073994 mRNA Translation: AAH73994.1
CCDSiCCDS11853.1 [Q53F39-1]
CCDS56054.1 [Q53F39-4]
RefSeqiNP_001229833.1, NM_001242904.1 [Q53F39-4]
NP_001306083.1, NM_001319154.1 [Q53F39-4]
NP_075563.3, NM_023075.5 [Q53F39-1]
XP_006722409.1, XM_006722346.2 [Q53F39-1]
XP_011524034.1, XM_011525732.1 [Q53F39-3]
XP_016881411.1, XM_017025922.1 [Q53F39-1]
XP_016881412.1, XM_017025923.1 [Q53F39-1]
XP_016881413.1, XM_017025924.1 [Q53F39-1]
XP_016881414.1, XM_017025925.1 [Q53F39-1]
XP_016881415.1, XM_017025926.1 [Q53F39-1]
XP_016881419.1, XM_017025930.1 [Q53F39-2]

3D structure databases

SMRiQ53F39
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122415, 80 interactors
IntActiQ53F39, 72 interactors
STRINGi9606.ENSP00000465894

PTM databases

GlyGeniQ53F39, 1 site
iPTMnetiQ53F39
PhosphoSitePlusiQ53F39

Polymorphism and mutation databases

BioMutaiMPPE1
DMDMi215274110

Proteomic databases

EPDiQ53F39
jPOSTiQ53F39
MassIVEiQ53F39
MaxQBiQ53F39
PaxDbiQ53F39
PeptideAtlasiQ53F39
PRIDEiQ53F39
ProteomicsDBi62456 [Q53F39-1]
62457 [Q53F39-2]
62458 [Q53F39-3]
62459 [Q53F39-4]
62460 [Q53F39-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1617, 132 antibodies

The DNASU plasmid repository

More...DNASUi		65258

Genome annotation databases

EnsembliENST00000309976; ENSP00000311200; ENSG00000154889 [Q53F39-4]
ENST00000317235; ENSP00000327257; ENSG00000154889 [Q53F39-4]
ENST00000496196; ENSP00000433950; ENSG00000154889 [Q53F39-2]
ENST00000588072; ENSP00000465894; ENSG00000154889 [Q53F39-1]
GeneIDi65258
KEGGihsa:65258
UCSCiuc002kqf.5, human [Q53F39-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		65258
DisGeNETi65258
EuPathDBiHostDB:ENSG00000154889.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		MPPE1
HGNCiHGNC:15988, MPPE1
HPAiENSG00000154889, Low tissue specificity
MIMi611900, gene
neXtProtiNX_Q53F39
OpenTargetsiENSG00000154889
PharmGKBiPA134913534

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3662, Eukaryota
GeneTreeiENSGT00390000013236
InParanoidiQ53F39
OMAiRTLHCMK
OrthoDBi1094620at2759
PhylomeDBiQ53F39

Enzyme and pathway databases

PathwayCommonsiQ53F39

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		65258, 38 hits in 843 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MPPE1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		65258
PharosiQ53F39, Tbio

Protein Ontology

More...PROi		PR:Q53F39
RNActiQ53F39, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000154889, Expressed in caudate nucleus and 234 other tissues
ExpressionAtlasiQ53F39, baseline and differential
GenevisibleiQ53F39, HS

Family and domain databases

CDDicd08165, MPP_MPPE1, 1 hit
Gene3Di3.60.21.10, 1 hit
InterProiView protein in InterPro
IPR004843, Calcineurin-like_PHP_ApaH
IPR029052, Metallo-depent_PP-like
IPR039541, MPP_MPPE1
IPR033308, PGAP5/Cdc1/Ted1
PANTHERiPTHR13315, PTHR13315, 1 hit
PfamiView protein in Pfam
PF00149, Metallophos, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPPE1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q53F39
Secondary accession number(s): B0YJ39
, B0YJ40, B0YJ41, B5ME53, B7WNJ3, D3DUI5, D3DUI7, Q6GMP1, Q8TAD6, Q8TE26, Q8WZ32, Q9BU58, Q9H958, Q9HAI4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: November 25, 2008
Last modified: December 2, 2020
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again