Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q52LJ0 (FA98B_HUMAN)

Entry version 140 (02 Jun 2021)
Sequence version 2 (08 May 2019)
Previous versions | rss
Add a publicationFeedback
Protein

Protein FAM98B

Gene

FAM98B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Positively stimulates PRMT1-induced protein arginine dimethylated arginine methylation (PubMed:28040436).

Promotes colorectal cancer cell malignancy (PubMed:28040436).

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:ENSG00000171262-MONOMER

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q52LJ0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6784531, tRNA processing in the nucleus

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM98B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM98B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26773, FAM98B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		616142, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q52LJ0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000171262.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		283742

Open Targets

More...OpenTargetsi		ENSG00000171262

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671778

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q52LJ0, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FAM98B

Domain mapping of disease mutations (DMDM)

More...DMDMi		74735811

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001871881 – 433Protein FAM98BAdd BLAST433

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q52LJ0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q52LJ0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q52LJ0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q52LJ0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q52LJ0

PeptideAtlas

More...PeptideAtlasi		Q52LJ0

PRoteomics IDEntifications database

More...PRIDEi		Q52LJ0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		2137
62424 [Q52LJ0-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q52LJ0

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q52LJ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q52LJ0

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q52LJ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (at protein level) (PubMed:28040436). Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (PubMed:28040436).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000171262, Expressed in metanephros and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q52LJ0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q52LJ0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000171262, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:28040436).

Component of the tRNA-splicing ligase complex (PubMed:21311021, PubMed:24870230).

Interacts with FAM98A (PubMed:28040436).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		129661, 76 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q52LJ0

Database of interacting proteins

More...DIPi		DIP-50585N

Protein interaction database and analysis system

More...IntActi		Q52LJ0, 17 interactors

Molecular INTeraction database

More...MINTi		Q52LJ0

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000380734

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q52LJ0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni303 – 433DisorderedSequence analysisAdd BLAST131

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM98 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3973, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00440000037341

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_038408_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q52LJ0

Identification of Orthologs from Complete Genome Data

More...OMAi		NDQQWIS

Database of Orthologous Groups

More...OrthoDBi		800008at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q52LJ0

TreeFam database of animal gene trees

More...TreeFami		TF320308

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018797, FAM98

The PANTHER Classification System

More...PANTHERi		PTHR31353, PTHR31353, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF10239, DUF2465, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: Q52LJ0-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRGPEPGPQP TMEGDVLDTL EALGYKGPLL EEQALTKAAE GGLSSPEFSE 
        60         70         80         90        100
LCIWLGSQIK SLCNLEESIT SAGRDDLESF QLEISGFLKE MACPYSVLIS 
       110        120        130        140        150
GDIKDRLKKK EDCLKLLLFL STELQASQIL QNKKHKNSQL DKNSEVYQEV 
       160        170        180        190        200
QAMFDTLGIP KSTTSDIPHM LNQVESKVKD ILSKVQKNHV GKPLLKMDLN 
       210        220        230        240        250
SEQAEQLERI NDALSCEYEC RRRMLMKRLD VTVQSFGWSD RAKVKTDDIA 
       260        270        280        290        300
RIYQPKRYAL SPKTTITMAH LLAAREDLSK IIRTSSGTSR EKTACAINKV 
       310        320        330        340        350
LMGRVPDRGG RPNEIEPPPP EMPPWQKRQE GGGGRGGWGG GGGGGGRGGG 
       360        370        380        390        400
GGGGGRGGWG GGGGGWGGGG GGGGGWGGGG GGGRGGFQGR GDYGGRGGYG 
       410        420        430 
GRGGYGGRGY GDPYGGGGGG GGGGGGGGGY RRY
Length:433
Mass (Da):45,547
Last modified:May 8, 2019 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4A46D5F04FAB2530
GO
Isoform 1 (identifier: Q52LJ0-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     301-330: LMGRVPDRGGRPNEIEPPPPEMPPWQKRQE → GVSFSTVENELMISYLMFLQILVYFSFMSW
     331-433: Missing.

Note: Dubious isoform due to intron retention.Curated
Show »
Length:330
Mass (Da):37,191
Checksum:iC56C3C230B99A35E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YNA1H0YNA1_HUMAN
Protein FAM98B
FAM98B
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22A → T in BAC04621 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_060151301 – 330LMGRV…QKRQE → GVSFSTVENELMISYLMFLQ ILVYFSFMSW in isoform 1. Add BLAST30
Alternative sequenceiVSP_060152331 – 433Missing in isoform 1. Add BLAST103

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK095745 mRNA Translation: BAC04621.1
AC109631 Genomic DNA No translation available.
AC116158 Genomic DNA No translation available.
BC093898 mRNA Translation: AAH93898.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10047.2 [Q52LJ0-2]

NCBI Reference Sequences

More...RefSeqi		NP_775882.2, NM_173611.3 [Q52LJ0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000397609; ENSP00000380734; ENSG00000171262 [Q52LJ0-2]
ENST00000491535; ENSP00000453166; ENSG00000171262 [Q52LJ0-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		283742

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:283742

UCSC genome browser

More...UCSCi		uc001zkb.3, human [Q52LJ0-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK095745 mRNA Translation: BAC04621.1
AC109631 Genomic DNA No translation available.
AC116158 Genomic DNA No translation available.
BC093898 mRNA Translation: AAH93898.1
CCDSiCCDS10047.2 [Q52LJ0-2]
RefSeqiNP_775882.2, NM_173611.3 [Q52LJ0-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi129661, 76 interactors
CORUMiQ52LJ0
DIPiDIP-50585N
IntActiQ52LJ0, 17 interactors
MINTiQ52LJ0
STRINGi9606.ENSP00000380734

PTM databases

iPTMnetiQ52LJ0
MetOSiteiQ52LJ0
PhosphoSitePlusiQ52LJ0
SwissPalmiQ52LJ0

Genetic variation databases

BioMutaiFAM98B
DMDMi74735811

Proteomic databases

EPDiQ52LJ0
jPOSTiQ52LJ0
MassIVEiQ52LJ0
MaxQBiQ52LJ0
PaxDbiQ52LJ0
PeptideAtlasiQ52LJ0
PRIDEiQ52LJ0
ProteomicsDBi2137
62424 [Q52LJ0-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2032, 102 antibodies

The DNASU plasmid repository

More...DNASUi		283742

Genome annotation databases

EnsembliENST00000397609; ENSP00000380734; ENSG00000171262 [Q52LJ0-2]
ENST00000491535; ENSP00000453166; ENSG00000171262 [Q52LJ0-1]
GeneIDi283742
KEGGihsa:283742
UCSCiuc001zkb.3, human [Q52LJ0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		283742
DisGeNETi283742

GeneCards: human genes, protein and diseases

More...GeneCardsi		FAM98B
HGNCiHGNC:26773, FAM98B
HPAiENSG00000171262, Low tissue specificity
MIMi616142, gene
neXtProtiNX_Q52LJ0
OpenTargetsiENSG00000171262
PharmGKBiPA142671778
VEuPathDBiHostDB:ENSG00000171262.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3973, Eukaryota
GeneTreeiENSGT00440000037341
HOGENOMiCLU_038408_1_1_1
InParanoidiQ52LJ0
OMAiNDQQWIS
OrthoDBi800008at2759
PhylomeDBiQ52LJ0
TreeFamiTF320308

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000171262-MONOMER
PathwayCommonsiQ52LJ0
ReactomeiR-HSA-6784531, tRNA processing in the nucleus

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		283742, 236 hits in 1005 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FAM98B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		283742
PharosiQ52LJ0, Tdark

Protein Ontology

More...PROi		PR:Q52LJ0
RNActiQ52LJ0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000171262, Expressed in metanephros and 225 other tissues
ExpressionAtlasiQ52LJ0, baseline and differential
GenevisibleiQ52LJ0, HS

Family and domain databases

InterProiView protein in InterPro
IPR018797, FAM98
PANTHERiPTHR31353, PTHR31353, 1 hit
PfamiView protein in Pfam
PF10239, DUF2465, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFA98B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q52LJ0
Secondary accession number(s): A8MUW5, Q8N935
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 8, 2019
Last modified: June 2, 2021
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again