Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein prune homolog 2

Gene

Prune2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play an important role in regulating differentiation, survival and aggressiveness of the tumor cells.By similarity

GO - Molecular functioni

  • exopolyphosphatase activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein prune homolog 2
Alternative name(s):
BNIP2 motif-containing molecule at the C-terminal region 1
Gene namesi
Name:Prune2
Synonyms:Bmcc1, Kiaa0367
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1925004 Prune2

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002748811 – 3084Protein prune homolog 2Add BLAST3084

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ52KR3
PeptideAtlasiQ52KR3
PRIDEiQ52KR3

PTM databases

iPTMnetiQ52KR3
PhosphoSitePlusiQ52KR3

Expressioni

Developmental stagei

In the embryo specifically expressed in neural tube and neural crest-related tissues. At E10.5, highly expressed in neural tube and pharyngeal arches which are derived from neural crest. Expression is more restricted in the later stages of development. At E12.5, expressed in spinal cord, hindbrain, midbrain, forebrain and dorsal root ganglia (DRG). Although the expression at E14.5 is similar to those in E12.5, the regions expressing in hindbrain, spinal cord and forebrain at E14.5 are more dorsally restricted than at E12.5.1 Publication

Inductioni

Down-regulated after nerve growth factor (NGF)-induced differentiation, and up-regulated during the NGF-depletion-induced apoptosis.1 Publication

Gene expression databases

BgeeiENSMUSG00000039126 Expressed in 207 organ(s), highest expression level in facial nucleus
CleanExiMM_A230083H22RIK
ExpressionAtlasiQ52KR3 baseline and differential
GenevisibleiQ52KR3 MM

Interactioni

Protein-protein interaction databases

IntActiQ52KR3, 2 interactors
STRINGi10090.ENSMUSP00000084977

Structurei

3D structure databases

ProteinModelPortaliQ52KR3
SMRiQ52KR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2879 – 3040CRAL-TRIOPROSITE-ProRule annotationAdd BLAST162

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi109 – 111DHH motifBy similarity3

Sequence similaritiesi

Belongs to the PPase class C family. Prune subfamily.Curated

Phylogenomic databases

eggNOGiENOG410IFIP Eukaryota
ENOG410ZS9Z LUCA
GeneTreeiENSGT00420000029688
HOGENOMiHOG000230952
HOVERGENiHBG081161
InParanoidiQ52KR3
KOiK18449
OMAiIDWEVET
OrthoDBiEOG091G0E88
PhylomeDBiQ52KR3
TreeFamiTF323914

Family and domain databases

CDDicd00170 SEC14, 1 hit
Gene3Di3.10.310.20, 1 hit
3.40.525.10, 1 hit
InterProiView protein in InterPro
IPR022181 Bcl2-/adenovirus-E1B
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR038763 DHH_sf
IPR004097 DHHA2
IPR038222 DHHA2_dom_sf
PfamiView protein in Pfam
PF12496 BNIP2, 1 hit
PF13716 CRAL_TRIO_2, 1 hit
PF02833 DHHA2, 1 hit
SMARTiView protein in SMART
SM01131 DHHA2, 1 hit
SM00516 SEC14, 1 hit
SUPFAMiSSF52087 SSF52087, 1 hit
SSF64182 SSF64182, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q52KR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEFLQRAKS KLDRSKQLEQ VHAVIGPKSC DLDSLISAFT YAYFLDKVSP
60 70 80 90 100
PGVLCLPVLN IPRTEFNYFT ETRFILEELN IPESFHIFRD EINLHQLNDE
110 120 130 140 150
GKLSITLVGS HVLGSEDRTL ESAVVRVINP GEQSDGELGF PETSSSLVLK
160 170 180 190 200
ELLREAPELI TQQLAHLLRG SILFTWMSMD PELPEKQEEI LSILEEQFPN
210 220 230 240 250
LPPRDDIINV LQESQLSAQG LSLEQTMLKD LKELSDGEIK VAISTVNMTL
260 270 280 290 300
EDYLLHGNIT SDLKAFTDKF GFDVLILISS FTWEEQQRQQ IAVYSQNLEL
310 320 330 340 350
CSQICCELEE SQNPCLELEP FECGCDEILV YQQEDPSVTS DQVFLLLKEV
360 370 380 390 400
INRRCAEMVS NSRTSSTEAV AGSAPLSQGS SGIMELYGSD IEPQPSSVNF
410 420 430 440 450
IENPPELNDS NQAQADGNID LVSPDSGLAT IRSSRSSKES SVFLSDDSPV
460 470 480 490 500
GDGGAPHHSL LPGFDSYSPI PEGIVAEEHA HSGEHSEHFD LFNFDSAPIA
510 520 530 540 550
SEQSQPSSHS ADYSPEDDFP NSDSSEGNLS AGPKGLGEMG INMSNYSSSS
560 570 580 590 600
LLSEAGKDSL VEFDEEFIQR QESSGDNSER NLSLTCFAGE EPSSPERLKN
610 620 630 640 650
PGKMIPPTPM NSFVEISPSN EEPTPLYPED IIQNAIDTGH LGPPQARARC
660 670 680 690 700
RSWWGGLEID SKNVVDTWNA SEQESVFQSP EPWKDPKPEP VERRTSDSTF
710 720 730 740 750
QPKSLEFSKS DPWESEFGQP ELGNKEAQDQ KEESLQYQHL PTVRPHLTDA
760 770 780 790 800
SPHGTNHLIE DFAALWHSGH SPTTMPEPWG NPTDAGEAAV TMSFPTWGAF
810 820 830 840 850
DKEEDNADTL KNTWNLHPTN NETPSGQEPS EWAMGQSGFS FPAADLLDNP
860 870 880 890 900
LIEVNKDAAP EIWGKNNSSK DTSLTSGSPT SDLGQTWNNS KLPGEDQNGL
910 920 930 940 950
VDPKATGKVY EKEGSWSLFE ESAKKRGADV LAPWEDSFLS YKCSDYSASN
960 970 980 990 1000
IGEDSVPSPL DTNYSTSDSY TSPTYAGDEK EIANKPVDKD NGFEAKDAEF
1010 1020 1030 1040 1050
PAEGLEVLAT SSQQSQRNRI GSGPGNLDMW ALPHTEDKPE GNDAHHPDSD
1060 1070 1080 1090 1100
ALKTEHAEDK NASMEDDVRE SSPSSYDDPS MMRLYEANRQ LTLLHSNTNS
1110 1120 1130 1140 1150
RQAAPDSLDT WNRVTLEDTQ STATISDMDN DLDWDDCSGG VAISGDGQAE
1160 1170 1180 1190 1200
GYIAANSEPE TRFSVKQLEP WGTEHQEANQ VDWDLSASAE PTGDPGPSEY
1210 1220 1230 1240 1250
QTLNEKTGQL IANSIWDSVM GDKNMPSFRL PSPPNTVDME HGTWPSESPR
1260 1270 1280 1290 1300
HSNGKDSHML EASRLSESGG LTSQPVNQDT WGDSQGDTAS SVTGLASPEH
1310 1320 1330 1340 1350
FAQSDPWTGH TYGQSESEIE GLVASDCEHL DKEAALGSGV NGAPWAFGKK
1360 1370 1380 1390 1400
PRDQEFSSSD AFEHQDISSA SGKISSLSVT SSPQSEEPGE ALEVEKEPFI
1410 1420 1430 1440 1450
LDSLAVQTET FTWDLQSKDT HEESLVDHRN LGEANTTLDR INPMKNRPLS
1460 1470 1480 1490 1500
GMELEKTEAC TILKPERANG KLLYESSQDF GVWDGPMDSD VWDSHISYET
1510 1520 1530 1540 1550
AMNSTGQRTE ERSLEALSPG NYDRDSLSSG CTHSSASSPD LHDSSVALSS
1560 1570 1580 1590 1600
WTYGPSAEHQ KENHDDANKQ IHQESELFTT EAHVDVITEM KDFVENREDG
1610 1620 1630 1640 1650
FGKMSNQEDP QFPEIPNDPF NSGPSSSSSS LGADKYSEYS HAYQEGDLTT
1660 1670 1680 1690 1700
KRQEENELGF LEIVEPEGTR IISTSSGSGN DSGGDEELLE KELHLATVAQ
1710 1720 1730 1740 1750
SEAGACTSLH EPAFSATEHS KPEFSVFVGS LESIEKENKS SPFSDSQQSS
1760 1770 1780 1790 1800
PGQWILSPLM QADTQDTCKE ETRAAETGTM DTTWHGSAST EAKNGDPDKL
1810 1820 1830 1840 1850
EMLGFSADST EWWNAGAQEG RANAGMSAEE LSNSEGELEP TSPVFQNAGP
1860 1870 1880 1890 1900
WSLPIQNDSE PVDTGSTNPF RGKLKSPVLD SHGDKSQEKL WNIQPKQLDS
1910 1920 1930 1940 1950
DANQLSQLVI LDQMKDKDSG QQTAMSPAAG DLPAETLTQG QGRESMLSVW
1960 1970 1980 1990 2000
DRAEPALTHR DENGCVSTGV SPTECQQENQ WEPEKPYLSH VTHSSTPTEN
2010 2020 2030 2040 2050
ALESNAPTQL MRKLDSDWNS PSPSEPQHNF VPDILHGNFE EGGQLASASP
2060 2070 2080 2090 2100
DLWMDVKQPF SFKVDSENPD ILTHCDHDSN SQASSSPDVC HDSEGEQKME
2110 2120 2130 2140 2150
KHTAVYLGLE VEPSEFSLTE PNMNDEPTWE PEQESLPHNS ELHSEHAMPL
2160 2170 2180 2190 2200
PPIDSQNDIN NSSKPASSRS SPEPSDMRGD NNTSVTSMEE DTNPEVEAVD
2210 2220 2230 2240 2250
SVTIPGHFPR SEDADTFEAH QEVSVEVDDS WVSKDLCPES QTGTRALLDC
2260 2270 2280 2290 2300
EQPFASESPA VLTDIFLTSD TCLDVSEAAL DHSFSDASGL NTSTGTIDDM
2310 2320 2330 2340 2350
SKLTLSEGHP ETPVDGDAGK QDVCSSEASW GDFEYDAMGQ NIDEELMREP
2360 2370 2380 2390 2400
EHFLYGGDLP SEESALKQSL TPYTPPFDLS YLTEPTGCTE TAQGAESPGD
2410 2420 2430 2440 2450
ESLGSDAAEM LLSALPDHRE EDKAETNIRK PRYQMTVLHI HEDPEALSSP
2460 2470 2480 2490 2500
VGGTGSNNES SPSNIDWEIE TDNSDSPAGG DMKPPNGKEI LELEEDEKVI
2510 2520 2530 2540 2550
PTKGPKQTEL EYKEEKQPEQ SEDHQVLAVD YILVSHEKDS PLKPEAREAR
2560 2570 2580 2590 2600
ENIPELEQLS IGSRETGLPE TQLSGTPDTC QSEFLNDVKV HSAERMSSSS
2610 2620 2630 2640 2650
NHESASLENP AQDQSWMVLS HSEVGDPPTE TRDSGPESPG RTPEPFLSLS
2660 2670 2680 2690 2700
LDKGPKSQVL ERNKPLNSLA LEEVAGLSSQ SRNIERQGQA GLDAVPTQAA
2710 2720 2730 2740 2750
THDNEWEMLS PQLSRKNRNP PQEMEEETQC PEPGPRKPRL KGPPSEDEGM
2760 2770 2780 2790 2800
DIHFEEGVLS PSAADMRPEP PNSLDLNGSH PRRIKLTAPN INLSLDQSEG
2810 2820 2830 2840 2850
SILSDDNLDS PDEIDINVDE LDTPDEADSF EYTNHEDPTA NKSSGQESES
2860 2870 2880 2890 2900
IPEYTAEEER EDNRLWRTVV IGEQEQRIDM KVIEPYRRVI SHGGYYGDGL
2910 2920 2930 2940 2950
NAIIVFAACF LPDSSRADYH YVMENLFLYV ISTLELMVAE DYMIVYLNGA
2960 2970 2980 2990 3000
TPRRKMPGLG WMKKCYQMID RRLRKNLKSF IIVHPSWFIR TILAVTRPFI
3010 3020 3030 3040 3050
SSKFSSKIKY VTSLSELSGL IPMDCIHIPE SIIKYDEEKS FKRSVRLDEE
3060 3070 3080
LREASEAAKT SCLYNDPEMS SMEKDIDMKL KEKP
Length:3,084
Mass (Da):339,516
Last modified:June 15, 2010 - v2
Checksum:iFAF4C3D4DFC6893A
GO
Isoform 2 (identifier: Q52KR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2749: Missing.
     2893-2893: G → GGDS
     3035-3046: Missing.

Show »
Length:326
Mass (Da):37,129
Checksum:iCE23D525780972B6
GO
Isoform 3 (identifier: Q52KR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2749: Missing.
     3035-3046: Missing.

Show »
Length:323
Mass (Da):36,870
Checksum:i43D7B84F390EEFC7
GO
Isoform 4 (identifier: Q52KR3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2749: Missing.
     3034-3075: KYDEEKSFKRSVRLDEELREASEAAKTSCLYNDPEMSSMEKD → N

Show »
Length:294
Mass (Da):33,581
Checksum:i1050B110DB012F0D
GO
Isoform 5 (identifier: Q52KR3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-263: DYLLHGNITSDL → VRKSGHSPLARG
     264-3084: Missing.

Show »
Length:263
Mass (Da):29,580
Checksum:i33EE6E86991DFBE2
GO
Isoform 6 (identifier: Q52KR3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3034-3075: KYDEEKSFKRSVRLDEELREASEAAKTSCLYNDPEMSSMEKD → N

Show »
Length:3,043
Mass (Da):334,701
Checksum:iF0AA70D27E97FCDC
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YDW6A0A286YDW6_MOUSE
Protein prune homolog 2
Prune2
321Annotation score:

Sequence cautioni

The sequence AAH94224 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD32217 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAE41506 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti132E → K in BAB32192 (PubMed:16141072).Curated1
Sequence conflicti146S → F in BAB32192 (PubMed:16141072).Curated1
Sequence conflicti156A → V in BAB32192 (PubMed:16141072).Curated1
Sequence conflicti2724M → L in BAE41506 (PubMed:16141072).Curated1
Sequence conflicti2740L → P in BAE41506 (PubMed:16141072).Curated1
Sequence conflicti2939A → V in AAH95978 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0229051 – 2749Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST2749
Alternative sequenceiVSP_039356252 – 263DYLLH…ITSDL → VRKSGHSPLARG in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_039357264 – 3084Missing in isoform 5. 1 PublicationAdd BLAST2821
Alternative sequenceiVSP_0229062893G → GGDS in isoform 2. 1 Publication1
Alternative sequenceiVSP_0393583034 – 3075KYDEE…SMEKD → N in isoform 4 and isoform 6. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_0229083035 – 3046Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172939 mRNA Translation: BAD32217.1 Different initiation.
AK020727 mRNA Translation: BAB32192.1
AK038997 mRNA Translation: BAC30198.1
AK054190 mRNA Translation: BAC35688.1
AK165582 mRNA Translation: BAE38273.1
AK170001 mRNA Translation: BAE41506.1 Different initiation.
AC126674 Genomic DNA No translation available.
AC128703 Genomic DNA No translation available.
AC147026 Genomic DNA No translation available.
BC094224 mRNA Translation: AAH94224.1 Different initiation.
BC095978 mRNA Translation: AAH95978.1
CCDSiCCDS50400.1 [Q52KR3-1]
RefSeqiNP_851993.3, NM_181348.4 [Q52KR3-1]
XP_006527217.1, XM_006527154.2 [Q52KR3-6]
UniGeneiMm.257354
Mm.489758

Genome annotation databases

EnsembliENSMUST00000087689; ENSMUSP00000084977; ENSMUSG00000039126 [Q52KR3-1]
ENSMUST00000223920; ENSMUSP00000153418; ENSMUSG00000039126 [Q52KR3-4]
ENSMUST00000225351; ENSMUSP00000153135; ENSMUSG00000039126 [Q52KR3-3]
GeneIDi353211
KEGGimmu:353211
UCSCiuc008gxf.2 mouse [Q52KR3-4]
uc008gxg.2 mouse [Q52KR3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172939 mRNA Translation: BAD32217.1 Different initiation.
AK020727 mRNA Translation: BAB32192.1
AK038997 mRNA Translation: BAC30198.1
AK054190 mRNA Translation: BAC35688.1
AK165582 mRNA Translation: BAE38273.1
AK170001 mRNA Translation: BAE41506.1 Different initiation.
AC126674 Genomic DNA No translation available.
AC128703 Genomic DNA No translation available.
AC147026 Genomic DNA No translation available.
BC094224 mRNA Translation: AAH94224.1 Different initiation.
BC095978 mRNA Translation: AAH95978.1
CCDSiCCDS50400.1 [Q52KR3-1]
RefSeqiNP_851993.3, NM_181348.4 [Q52KR3-1]
XP_006527217.1, XM_006527154.2 [Q52KR3-6]
UniGeneiMm.257354
Mm.489758

3D structure databases

ProteinModelPortaliQ52KR3
SMRiQ52KR3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ52KR3, 2 interactors
STRINGi10090.ENSMUSP00000084977

PTM databases

iPTMnetiQ52KR3
PhosphoSitePlusiQ52KR3

Proteomic databases

PaxDbiQ52KR3
PeptideAtlasiQ52KR3
PRIDEiQ52KR3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000087689; ENSMUSP00000084977; ENSMUSG00000039126 [Q52KR3-1]
ENSMUST00000223920; ENSMUSP00000153418; ENSMUSG00000039126 [Q52KR3-4]
ENSMUST00000225351; ENSMUSP00000153135; ENSMUSG00000039126 [Q52KR3-3]
GeneIDi353211
KEGGimmu:353211
UCSCiuc008gxf.2 mouse [Q52KR3-4]
uc008gxg.2 mouse [Q52KR3-1]

Organism-specific databases

CTDi158471
MGIiMGI:1925004 Prune2
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IFIP Eukaryota
ENOG410ZS9Z LUCA
GeneTreeiENSGT00420000029688
HOGENOMiHOG000230952
HOVERGENiHBG081161
InParanoidiQ52KR3
KOiK18449
OMAiIDWEVET
OrthoDBiEOG091G0E88
PhylomeDBiQ52KR3
TreeFamiTF323914

Miscellaneous databases

ChiTaRSiPrune2 mouse
PROiPR:Q52KR3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000039126 Expressed in 207 organ(s), highest expression level in facial nucleus
CleanExiMM_A230083H22RIK
ExpressionAtlasiQ52KR3 baseline and differential
GenevisibleiQ52KR3 MM

Family and domain databases

CDDicd00170 SEC14, 1 hit
Gene3Di3.10.310.20, 1 hit
3.40.525.10, 1 hit
InterProiView protein in InterPro
IPR022181 Bcl2-/adenovirus-E1B
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
IPR038763 DHH_sf
IPR004097 DHHA2
IPR038222 DHHA2_dom_sf
PfamiView protein in Pfam
PF12496 BNIP2, 1 hit
PF13716 CRAL_TRIO_2, 1 hit
PF02833 DHHA2, 1 hit
SMARTiView protein in SMART
SM01131 DHHA2, 1 hit
SM00516 SEC14, 1 hit
SUPFAMiSSF52087 SSF52087, 1 hit
SSF64182 SSF64182, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPRUN2_MOUSE
AccessioniPrimary (citable) accession number: Q52KR3
Secondary accession number(s): Q501M3
, Q6A079, Q8BW65, Q8BYM6, Q9D217
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 15, 2010
Last modified: November 7, 2018
This is version 103 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again