Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (08 May 2019)
Sequence version 2 (21 Sep 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Serine/arginine repetitive matrix protein 1

Gene

Srrm1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, RNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-72163 mRNA Splicing - Major Pathway
R-MMU-72187 mRNA 3'-end processing
R-MMU-73856 RNA Polymerase II Transcription Termination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/arginine repetitive matrix protein 1
Alternative name(s):
Plenty-of-prolines 101
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Srrm1
Synonyms:Pop101
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1858303 Srrm1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000763271 – 946Serine/arginine repetitive matrix protein 1Add BLAST946

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei7Citrulline1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki127Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei140N6-acetyllysineCombined sources1
Modified residuei220PhosphoserineCombined sources1
Modified residuei227PhosphoserineBy similarity1
Cross-linki231Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki231Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei234PhosphoserineBy similarity1
Modified residuei240PhosphoserineBy similarity1
Modified residuei241PhosphothreonineBy similarity1
Cross-linki249Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei260PhosphoserineCombined sources1
Modified residuei387PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei391PhosphoserineCombined sources1
Modified residuei400PhosphoserineBy similarity1
Modified residuei404PhosphothreonineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei414PhosphothreonineBy similarity1
Modified residuei418PhosphoserineBy similarity1
Modified residuei427PhosphoserineCombined sources1
Modified residuei429PhosphoserineCombined sources1
Modified residuei434PhosphoserineBy similarity1
Cross-linki445Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei448PhosphoserineBy similarity1
Modified residuei450PhosphoserineBy similarity1
Cross-linki457Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei461PhosphoserineBy similarity1
Modified residuei463PhosphoserineBy similarity1
Cross-linki470Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei476PhosphoserineBy similarity1
Modified residuei522PhosphoserineBy similarity1
Modified residuei524PhosphoserineBy similarity1
Modified residuei526PhosphoserineBy similarity1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei561PhosphoserineBy similarity1
Modified residuei563PhosphoserineBy similarity1
Modified residuei572PhosphoserineCombined sources1
Modified residuei574PhosphoserineCombined sources1
Modified residuei593PhosphothreonineBy similarity1
Modified residuei600PhosphothreonineBy similarity1
Modified residuei602PhosphoserineBy similarity1
Modified residuei615PhosphotyrosineBy similarity1
Modified residuei616PhosphoserineCombined sources1
Modified residuei624PhosphoserineBy similarity1
Modified residuei626PhosphoserineBy similarity1
Modified residuei633PhosphothreonineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei645PhosphoserineBy similarity1
Modified residuei647PhosphoserineBy similarity1
Modified residuei655PhosphoserineBy similarity1
Modified residuei657PhosphoserineCombined sources1
Modified residuei713PhosphoserineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei725PhosphoserineCombined sources1
Modified residuei731PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1
Modified residuei736PhosphothreonineBy similarity1
Modified residuei779PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei789PhosphoserineBy similarity1
Modified residuei793PhosphoserineBy similarity1
Modified residuei795PhosphoserineCombined sources1
Modified residuei797PhosphoserineCombined sources1
Modified residuei810PhosphoserineCombined sources1
Modified residuei814PhosphoserineCombined sources1
Modified residuei816PhosphoserineCombined sources1
Modified residuei818PhosphoserineCombined sources1
Modified residuei819PhosphothreonineCombined sources1
Modified residuei822PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei834PhosphothreonineCombined sources1
Modified residuei836PhosphoserineCombined sources1
Modified residuei838PhosphoserineCombined sources1
Modified residuei843PhosphoserineCombined sources1
Modified residuei913PhosphothreonineCombined sources1
Modified residuei915PhosphoserineCombined sources1
Modified residuei943PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Citrullinated by PADI4.1 Publication
Phosphorylated on multiple serine and threonine residues by DYRK3 during the G2-to-M transition, after the nuclear-envelope breakdown. Phosphorylation by DYRK3 promotes disassembly of nuclear speckles.By similarity

Keywords - PTMi

Acetylation, Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q52KI8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q52KI8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q52KI8

PeptideAtlas

More...
PeptideAtlasi
Q52KI8

PRoteomics IDEntifications database

More...
PRIDEi
Q52KI8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q52KI8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q52KI8

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in the spliceosome C complex. Found in a pre-mRNA splicing complex with SFRS4, SFRS5, SNRP70, SNRPA1, SRRM1 and SRRM2. Found in a pre-mRNA exonic splicing enhancer (ESE) complex with SNRP70, SNRPA1, SRRM1 and TRA2B/SFRS10. Found in a mRNA splicing-dependent exon junction complex (EJC) with DEK, PRPF8, NCBP1, RBM8A, RNPS1, SRRM1 and ALYREF/THOC4. Interacts with BAT1, CPSF1, RBM8A, RNPS1, and ALYREF/THOC4. Seems to be a compound of RNA export complexes that are released from speckles in a ATP-dependent manner.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206179, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q52KI8, 2 interactors

Molecular INTeraction database

More...
MINTi
Q52KI8

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000125003

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q52KI8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 126PWIPROSITE-ProRule annotationAdd BLAST100

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 156Necessary for mRNA 3'-end cleavage and cytoplasmic accumulationBy similarityAdd BLAST156
Regioni1 – 151Necessary for DNA and RNA-bindingBy similarityAdd BLAST151
Regioni298 – 707Necessary for speckles and matrix localizationBy similarityAdd BLAST410

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi163 – 767Arg-richAdd BLAST605
Compositional biasi276 – 500Ser-richAdd BLAST225
Compositional biasi309 – 415Pro-richAdd BLAST107
Compositional biasi562 – 839Pro-richAdd BLAST278
Compositional biasi850 – 876Lys-richAdd BLAST27

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the splicing factor SR family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2146 Eukaryota
ENOG4111IMU LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168326

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q52KI8

KEGG Orthology (KO)

More...
KOi
K13171

Database of Orthologous Groups

More...
OrthoDBi
1210775at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002483 PWI_dom
IPR036483 PWI_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01480 PWI, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00311 PWI, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101233 SSF101233, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51025 PWI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q52KI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAGFFRGTS AEQDNRFSNK QKKLLKQLKF AECLEKKVDM SKVNLEVIKP
60 70 80 90 100
WITKRVTEIL GFEDDVVIEF IFNQLEVKNP DSKMMQINLT GFLNGKNARE
110 120 130 140 150
FMGELWPLLL SAQENIAGIP SAFLELKKEE IKQRQIEQEK LASLKKQDED
160 170 180 190 200
KDKRDKEEKE SSREKRERSR SPRRRKSRSP SPRRRSSPVR RERKRSHSRS
210 220 230 240 250
PRHRTKSRSP SPAPEKKEKS PELPEPSVRM KDSSVQEATS TSDILKAPKP
260 270 280 290 300
EPVPEPKEPS PEKNSKKEKE KTRPRSRSRS KSRSRTRSRS PSHTRPRRRH
310 320 330 340 350
RSRSRSYSPR RRPSPRRRPS PRRRTPPRRM PPPPRHRRSR SPGRRRRRSS
360 370 380 390 400
ASLSGSSSSS SSSRSRSPPK KPPKRTSSPP RKTRRLSPSA SPPRRRHRPS
410 420 430 440 450
SPATPPPKTR HSPTPQQSNR TRKSRVSVSP GRTSGKVTKH KGTEKRESPS
460 470 480 490 500
PAPKPRKVEL SESEEDKGSK MAAADSVQQR RQYRRQNQQS SSDSGSSSTS
510 520 530 540 550
EDERPKRSHV KNGEVGRRRR HSPSRSASPS PRKRQKETSP RMQMGKRWQS
560 570 580 590 600
PVTKSSRRRR SPSPPPARRR RSPSPAPPPP PPPPPPRRRR SPTPPPRRRT
610 620 630 640 650
PSPPPRRRSP SPRRYSPPIQ RRYSPSPPPK RRTASPPPPP KRRASPSPPP
660 670 680 690 700
KRRVSHSPPP KQRSPTVTKR RSPSLSSKHR KGSSPGRSTR EARSPQPNKR
710 720 730 740 750
HSPSPRPRAP QTSSPPPVRR GASASPQGRQ SPSPSTRPIR RVSRTPEPKK
760 770 780 790 800
IKKTAMATQR NIRRVSKSPK ADSLSRAASP SPQSVRRVSS SRSVSGSPEP
810 820 830 840 850
AAKKPPAPPS PVQSQSPSTN WSPAVPAKKA KSPTPSLSPA RNSDQEGGGK
860 870 880 890 900
KKKKKKDKKH KKDKKHKKHK KHKKEKAVTI ATPATAAPAA VSAATTTSAQ
910 920 930 940
EEPAAAPEPR KETESEAEDD NLDDLERHLR EKALRSMRKA QVSPQS
Length:946
Mass (Da):106,862
Last modified:September 21, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i41F77542412A9536
GO
Isoform 2 (identifier: Q52KI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-755: Missing.
     911-946: KETESEAEDDNLDDLERHLREKALRSMRKAQVSPQS → EVFTPPLPAV

Show »
Length:897
Mass (Da):101,103
Checksum:iC648F17FBD19FED1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PUK6E9PUK6_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
923Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A8V9A2A8V9_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
918Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A8V8A2A8V8_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
909Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QKA4E9QKA4_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
897Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A983A2A983_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6T4M4F6T4M4_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BWM1F7BWM1_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UK16F6UK16_MOUSE
Serine/arginine repetitive matrix p...
Srrm1
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti187S → Y in BAB25575 (PubMed:16141072).Curated1
Sequence conflicti521H → L in AAC17422 (Ref. 1) Curated1
Sequence conflicti754 – 761TAMATQRN → AASPSTRP in AAH94322 (PubMed:15489334).Curated8
Sequence conflicti767 – 776KSPKADSLSR → RTPEPKKIKK in AAH94322 (PubMed:15489334).Curated10
Sequence conflicti851K → R in AAC17422 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016524733 – 755Missing in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_016525911 – 946KETES…VSPQS → EVFTPPLPAV in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF062655 mRNA Translation: AAC17422.1
AL627078 Genomic DNA No translation available.
AL627185 Genomic DNA No translation available.
BC094322 mRNA Translation: AAH94322.1
AK008284 mRNA Translation: BAB25575.1

NCBI Reference Sequences

More...
RefSeqi
NP_058079.2, NM_016799.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51796

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:51796

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062655 mRNA Translation: AAC17422.1
AL627078 Genomic DNA No translation available.
AL627185 Genomic DNA No translation available.
BC094322 mRNA Translation: AAH94322.1
AK008284 mRNA Translation: BAB25575.1
RefSeqiNP_058079.2, NM_016799.3

3D structure databases

SMRiQ52KI8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206179, 1 interactor
IntActiQ52KI8, 2 interactors
MINTiQ52KI8
STRINGi10090.ENSMUSP00000125003

PTM databases

iPTMnetiQ52KI8
PhosphoSitePlusiQ52KI8

Proteomic databases

EPDiQ52KI8
jPOSTiQ52KI8
PaxDbiQ52KI8
PeptideAtlasiQ52KI8
PRIDEiQ52KI8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi51796
KEGGimmu:51796

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10250
MGIiMGI:1858303 Srrm1

Phylogenomic databases

eggNOGiKOG2146 Eukaryota
ENOG4111IMU LUCA
HOGENOMiHOG000168326
InParanoidiQ52KI8
KOiK13171
OrthoDBi1210775at2759

Enzyme and pathway databases

ReactomeiR-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-72163 mRNA Splicing - Major Pathway
R-MMU-72187 mRNA 3'-end processing
R-MMU-73856 RNA Polymerase II Transcription Termination

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Srrm1 mouse

Protein Ontology

More...
PROi
PR:Q52KI8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

InterProiView protein in InterPro
IPR002483 PWI_dom
IPR036483 PWI_dom_sf
PfamiView protein in Pfam
PF01480 PWI, 1 hit
SMARTiView protein in SMART
SM00311 PWI, 1 hit
SUPFAMiSSF101233 SSF101233, 1 hit
PROSITEiView protein in PROSITE
PS51025 PWI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRRM1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q52KI8
Secondary accession number(s): E9QNW8, O70495, Q9CVG5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: September 21, 2011
Last modified: May 8, 2019
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again